Identifiers and Description

Gene Model Identifier

TTHERM_00835340

Standard Name

LSM7 (Lsm (Like Sm) protein 7)

Aliases

PreTt24549 | 145.m00116

Description

LSM7 U6 snRNA associated-like-Smprotein; Sm protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_16808.1 4.000904604388404e-59
Description: Sm protein (105 aa)
WormBase WBGene00003081 7.002785992501305e-33
Description: locus:lsm-7 status:Confirmed UniProt:Q23543 protein_id:CAA93428.1
DictyBase DDB_G0289499 2.998800627344286e-26
Description: lsm7 on chromosome: 5 position 2859869 to 2860286
Oxytricha Contig18849.0.g107 3.999672240330216e-26
Description: LSM domain
SGD YNL147W 5.000468829272308e-18
Description: LSM7 Lsm (Like Sm) protein; part of heteroheptameric complexes (Lsm2p-7p and either Lsm1p or 8p): cytoplasmic Lsm1p complex involved in mRNA decay; nuclear Lsm8p complex part of U6 snRNP and possibly involved in processing tRNA, snoRNA, and rRNA

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00835340(coding)
ATGTCAGGTGGTTAAAAGTAGTAAAAAGAGTCGATCATTAATCTTTCTTAATATGTTGGA
AAAGATATTCGTGTTAAATTTTAGGGAGGCAGAGAAGTGACAGGTGTTTTAAAAAGTTTT
GATAATTAACTCAATATGATTTTAGATGATTGCGTTGAAACTATAAGAGATAAAAATGAT
CCTTATTTGATGACAGAACAAAAAAGAAAGTTGAATTTAGTAGTTGTTAGAGGAACTTTG
GTTTCTACCATATTCCCAATGAGCGGCACAGAAATAATTGAAAATCCTTTTGTAAACATG
GAAGAATAGTGA


>TTHERM_00835340(gene)
ATGTCAGGTGGTTAAAAGTAGTAAAAAGAGTCGATCATTAATCTTTCTTAATATGTTGGA
AAAGATATTCGTGTTAAATTTTAGGGAGGCAGAGAAGTGACAGGTGTTTTAAAAAGTTTT
GATAATTAACTCAATATGATTTTAGATGATTGCGTTGAAACTATAAGAGGTAATTTAAAT
TTTAAAATAGAATTTGCTGCAAAAAAATAGTTTTAAGGAGAAGCCTCATTTAATTGAAAT
ATTTTATTAAAATAGATAAAAATGATCCTTATTTGATGACAGAACAAAAAAGAAAGTTGA
ATTTAGTAGTTGTTAGAGGAACTTTGGTAAATTTAAATCTATTTAATAAATAAATTAAAT
AAATGAGTAAATAAATATAAATAAATTATTAAAATGAACAGGTTTCTACCATATTCCCAA
TGAGCGGCACAGAAATAATTGAAAATCCTTTTGTAAACATGGAAGAATAGTGA


>TTHERM_00835340(protein)
MSGGQKQQKESIINLSQYVGKDIRVKFQGGREVTGVLKSFDNQLNMILDDCVETIRDKND
PYLMTEQKRKLNLVVVRGTLVSTIFPMSGTEIIENPFVNMEEQ