Identifiers and Description

Gene Model Identifier

TTHERM_00835350

Standard Name

DSK2 (DSK2 ortholog)

Aliases

PreTt24550 | 145.m00117

Description

DSK2 ubiquitin-like Rad60 SUMO-like protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_16807.1 4.999878681532552e-93
Description: ubiquitin family protein (561 aa)
SGD YMR276W 7.002785992501305e-33
Description: DSK2 Nuclear-enriched ubiquitin-like polyubiquitin-binding protein, required for spindle pole body (SPB) duplication and for transit through the G2/M phase of the cell cycle, involved in proteolysis, interacts with the proteasome
WormBase WBGene00008852 2.000769134519826e-18
Description: locus:ubql-1 status:Confirmed UniProt:G5EFF7 protein_id:CAA95799.1
DictyBase DDB_G0267452 6.001122775063233e-17
Description: sonA on chromosome: 1 position 1168646 to 1170444
Oxytricha Contig457.0.g18 0.00003998524687536623
Description: Ubiquitin family

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00835350(coding)
ATGGAAGGAGAAATTATTGTAAAACTAAAACTTTCCAATGAAGGAACCTTTGAAATTAAG
ATTGACCCTAAGGCCACTGTTTTGTAGTTTAAGGAAAAGATTGCTAAGGAAAAGAATTGC
GAAACTGGTCACATTAAGCTGATTTACAAAGGAAAATGGTTGAAGAATGATGAAGAAACT
TTGGAACATAACAAAGTTATTGATGGAAACACAATGCACATTATCATTAATAAGCCTAAT
GAAGCTGATAATAGCAACACCACTAATGCTTAAACCAGTTCTACAACTAATACAACCTCT
TCATCTACTTCAAGTCAAGTTCCTAACAACTTGAATGCTGGTTAAGGTTAAAATCCCTTT
GCCTCTTTGGGAGGTTTAGGAGGACTTGGTGGACTTGGCGGTCTTGGTGGTCTCGGAGGT
TTGGGAGCTAATGGTTAACTTGACCCTAATGACCTTGCCTAAGCTATGCAATCTCCTTAA
GTACAATAAATGATGTAATAGATGCTTTCCAACCCATAAGCTCTCCAACAAATGCTCCAA
TAGAATCCTTACACCAGATAAATGCTTGAACAAAATCCTCAACTCTTATAAATGCTTTCT
GACCCCATGATGATTTAAATGATTAGTAACCCTTAATTCTTACAAAATGCCATGCAAATG
ATGGGTAATAATGGTGGCATGGGTGGCATGGGAGGCCTTGGTGGTCTAGGAGGACTTGGC
GGATTAGGAGGACTCGGTGGTTTAGGTGCTTTTGGTTAACAATAACCTTAATAATAGGCA
TAATAATAAGCATAATAATAGGGATAATAAGGAACTTAATAAACAGGATAATAATAATAA
TAGTAACCTGGTTAATTACCTCCTTTCAATTTTGCTCAATTGTTAAACAATCCTTTATTC
GGAGGAATGGGTGGTATGGGCGGCTTAGGAGGTTTCGGATTCCCTCCTGCTCAATAAGAC
AACACCCCTCCTGAAGAAAAATATAAGGAATAGTTAGCTCAATTAGAAGTTATGGGTTTT
ACTAACAAATAAGTTAACCTTGAAGCTCTTAAGGCTACAGGTGGTAACGTTGAAGCTGCT
ATTGAACGTATTTTAAACATGCTTGGTTGA


>TTHERM_00835350(gene)
ATGGAAGGAGAAATTATTGTAAAACTAAAACTTTCCAATGAAGGAACCTTTGAAATTAAG
ATTGACCCTAAGGCCACTGTTTTGTAGTTTAAGGAAAAGATTGCTAAGGAAAAGAATTGC
GAAACTGGTCACATTAAGCTGATTTACAAAGGTATAATTTTTAGATATTTTGTTTTATTG
TCCATGATTTTTTGCAATCAAGCAAAAAGATCAAACAGAGATAAGATTTTATACAGAATA
ACAAAATAAAGCTTATTTCTTTCGCAATTTACTTTTGAATAATTGACTTATTTTGTTTTT
ATTAACCAAATTTATAGGAAAATGGTTGAAGAATGATGAAGAAACTTTGGAACATAACAA
AGTTATTGATGGAAACACAATGCACATTATCATTAATAAGCGTAAGCAAGCATTAATTAA
CAAAAGGTTTTCATAGCAAATATAAAATGTTCACTTAGCAAGCAAGACATTTTATATTAC
TTAAACTAAATATTTTTTAGAATTTTGAGCAATAATTTTATTTAAAAAATAATAATTAGC
TAATGAAGCTGATAATAGCAACACCACTAATGCTTAAACCAGTTCTACAACTAATACAAC
CTCTTCATCTACTTCAAGTCAAGTTCCTAACAACTTGAATGCTGGTTAAGGTTAAAATCC
CTTTGCCTCTTTGGGAGGTTTAGGAGGACTTGGTGGACTTGGCGGTCTTGGTGGTCTCGG
AGGTTTGGGAGCTAATGGTTAACTTGACCCTAATGACCTTGCCTAAGCTATGCAATCTCC
TTAAGTACAATAAATGATGTAATAGGTAATAAGCTTTTCATAATTTGACTTTTTAAACAC
AAATACGCATGTTTTATAATGTTATTTATATCTAATTTTATTAACAAACAGATGCTTTCC
AACCCATAAGCTCTCCAACAAATGCTCCAATAGAATCCTTACACCAGATAAATGCTTGAA
CAAAATCCTCAACTCTTAGTAAGAAATTTAACTCTTTAAATCAATAAATAAATAAAACAA
AGCAAAAAAGTTAGAAATGAGCAAAGAAATTAAAGAATAAAAAAACAAAAAAGTAGATAA
ATAAATGAATGAATAATTAAATAAATGAAGTTTTCAATAAAATAATAAAAAAAGGAATTA
GCAGATAAAGATTTCAGAATATATTTAAAATATATTGAATTTTTAAAATCAATTTATTTA
ATGGTTTTTATTAATTAATTATTTAGTAAATGCTTTCTGACCCCATGATGATTTAAATGA
TTAGTAACCCTTAATTCTTACAAAATGCCATGCAAATGATGGGTAATAATGGTGGCATGG
GTGGCATGGGAGGCCTTGGTGGTCTAGGAGGACTTGGCGGATTAGGAGGACTCGGTGGTT
TAGGTGCTTTTGGTTAACAATAACCTTAATAATAGGCATAATAATAAGCATAATAATAGG
GATAATAAGGAACTTAATAAACAGGATAATAATAATAATAGTAACCTGGTTAATTACCTC
CTTTCAATTTTGCTCAATTGTTAAACAATCGTAAATTCAATATTTTTTTATCACATTTTA
TTAAAATTGTTTTGAATTAATTAATAGCTTTATTCGGAGGAATGGGTGGTATGGGCGGCT
TAGGAGGTTTCGGATTCCCTCCTGCTCAATAAGACAACACCCCTCCTGAAGAAAAATATA
AGGAATAGTTAGCTCAATTAGAAGTTATGGGTTTTACTAACAAATAAGTTAACCTTGAAG
CTCTTAAGGCTACAGGTGGTAACGTTGAAGCTGCTATTGAACGTATTTTAAACATGCTTG
GTTGA


>TTHERM_00835350(protein)
MEGEIIVKLKLSNEGTFEIKIDPKATVLQFKEKIAKEKNCETGHIKLIYKGKWLKNDEET
LEHNKVIDGNTMHIIINKPNEADNSNTTNAQTSSTTNTTSSSTSSQVPNNLNAGQGQNPF
ASLGGLGGLGGLGGLGGLGGLGANGQLDPNDLAQAMQSPQVQQMMQQMLSNPQALQQMLQ
QNPYTRQMLEQNPQLLQMLSDPMMIQMISNPQFLQNAMQMMGNNGGMGGMGGLGGLGGLG
GLGGLGGLGAFGQQQPQQQAQQQAQQQGQQGTQQTGQQQQQQPGQLPPFNFAQLLNNPLF
GGMGGMGGLGGFGFPPAQQDNTPPEEKYKEQLAQLEVMGFTNKQVNLEALKATGGNVEAA
IERILNMLG