Identifiers and Description

Gene Model Identifier

TTHERM_00853150

Standard Name

RDR1 (RNA-Dependent RNA polymerase 1)

Aliases

PreTt01214 | 150.m00106 | 3834.m00380

Description

RDR1 RNA-dependent RNA polymerase RdRP2; RNA-Dependent RNA polymerase; associated with RNA silencing

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF05183 ) RNA dependent RNA polymerase
  • ( PF08651 ) DASH complex subunit Duo1
  • ( TIGR00087 ) 5'/3'-nucleotidase SurE

Gene Expression Profile

Tetrahymena Stock Center

  • ( SD02508 ) Micronucleus: neo2 into RDR1
  • ( SD02509 ) Micronucleus: neo2 into RDR1
  • ( SD02510 ) Micronucleus: neo2 into RDR1
  • ( SD02511 ) Micronucleus: neo2 into RDR1
  • ( SD02512 ) Macronucleus: HA-FLAG tag of RDR1
  • ( SD02513 ) Macronucleus: HA-FLAG tagged RDR1 with neo3 in flank
  • ( SD02514 ) Macronucleus: HA-FLAG tagged RDR1 with neo3 in flank
  • ( SD02515 ) Macronucleus: HA-FLAG tagged RDR1 with neo3 in flank

Homologs

Source Identifier Score
Tetrahymena borealis EI9_15934.1 9.997093137033517e-262
Description: RNA dependent RNA polymerase (1446 aa)
Oxytricha Contig20928.0.g67 5.001369568193564e-73
Description: RNA dependent RNA polymerase
DictyBase DDB_G0291249 6.999507172836373e-51
Description: rrpB on chromosome: 6 position 442657 to 449964
WormBase WBGene00004510 2.99915080840225e-45
Description: locus:rrf-3 status:Partially_confirmed UniProt:G5EE53 protein_id:CAA88315.2
Stentor Coeruleus SteCoe_15527 4.0795586671775603e-41
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22706992: Talsky KB, Collins K (2012) Strand-asymmetric endogenous Tetrahymena small RNA production requires a previously uncharacterized uridylyltransferase protein partner. RNA (New York, N.Y.) 18(8):1553-62
  2. Ref:20622019: Talsky KB, Collins K (2010) Initiation by a eukaryotic RNA-dependent RNA polymerase requires looping of the template end and is influenced by the template-tailing activity of an associated uridyltransferase. The Journal of biological chemistry 285(36):27614-23
  3. Ref:19451546: Lee SR, Talsky KB, Collins K (2009) A single RNA-dependent RNA polymerase assembles with mutually exclusive nucleotidyl transferase subunits to direct different pathways of small RNA biogenesis. RNA (New York, N.Y.) 15(7):1363-74
  4. Ref:19656801: Couvillion MT, Lee SR, Hogstad B, Malone CD, Tonkin LA, Sachidanandam R, Hannon GJ, Collins K (2009) Sequence, biogenesis, and function of diverse small RNA classes bound to the Piwi family proteins of Tetrahymena thermophila. Genes & development 23(17):2016-32
  5. Ref:17603500: Lee SR, Collins K (2007) Physical and functional coupling of RNA-dependent RNA polymerase and Dicer in the biogenesis of endogenous siRNAs. Nature structural & molecular biology 14(7):604-10

Sequences

>TTHERM_00853150(coding)
ATGATTGAACAATCTATAGAAGAGGAAAAAATCATATGCTGTATAGGCTATATAAATGGA
AAGATAACTTCTAAAAACTTTACTACCTCATTATGCTTTGCATCAATATAAAAATATCTT
TAAGAGCAACAACATAGATTTAAAAGCATTAAATGTGTCTCTATTTATACTCCAAAAAAG
GAGCAATAGTAGATTGGTTTAGATACCATTGATGATGTTAAGGAAAAAATAAAAGAGATA
CAGAAATCTATTGATCATAATTATTTGAATATACCTCAACACCTGAAAGAAGAGAGATAT
AGAGTAAACTATAAAAGCTTAAATTTTTAGGAAGGTTAATAGTCTTTGGATAATGATGAT
GATAGCAATTTACTTGGTAGTGAATATTAGTTTTTAAAAAACTTTATTACAAAAGAAAAT
GATGATATTCATCTGAAGGAAGAAATGGCTAGCTTTAATAAAATAGAAAGCTTTTGTTAA
AATGTATTAAAGAACTCTAAAAATGAGTCTAAAATAAATACTGTAAACTAATAAAAAGAT
TAGTATGCAAGGATAAATAGCTGGATTATAATTTTAAGTGGAACGGAATAGGATTTAGAA
GTTCTGAACGATTCAAAGATTGATGTAAAGACAAAACATGAAAAATATTACTTCTTTTTA
AAAACAAAACATAATGACAACGAAAAAAAAAATTATTTGAAAATTTGTACTGATGAATTA
TCGAATTATGCTAAGGAATAGATGAATTTTGTAAATATAAAATTGCTTCAAGTTAGTTTA
GGGATATTTGAATTATACGGCGGTGCTTTATACTACAATTGTTAGTTTTAATTTGAAGAA
AACATAGACTATGTAAACACAATCAGCATCTATATGTAAAATGATGAATCAGAGAGCAAG
TAAAAATAGTAATCGGTATCTATTGTGTTAGCATATAATGATTATTAGCTAAAAATTGAG
TTTCCATATTTATATTGCAATGAAATAAGATTTGATTAAAGAGGTAAAAATATGTATTAC
TTTTAATTAGTTGTTCCTCCTAAATATTTTGTCAGAGAAAATTCAGCTAATATTTAAGAA
AACTTGGATTAAAAAAAGAACACTTGGATTAGAGTAGATAACTTCTTTGCTCATGACATC
AGTAATGAGCTTAAAAGAATAGAATTTGTAAACAATACAGTTATTTGTATTGAGATAGAA
AATGAAACAGTCAATACATTCTAAACGATACTTAAAAATTCTTTTTCAAACGTGTTTAAA
GATACAGACCCTATTCCTATTTCAAATGTGTCACAACATTTTCCTTAAGAACCTGAAAAT
GATTTAGACTAATAATGGGAAAGACTTCTAAATAGATATTCATTCAATTTAAGCTATTCG
ATCTTAACACTAATATCTCACAATAAACTAAGTGTCGTCAAATTAAGAGAATTTCTTGAC
TATATAGATCTTTAAATAAGAGATGGTAAATCAGAGTATATATTAGAAAAAGGAATTTAG
TATTATTACAACTAAAAGAAAGAAATTAATCGCCTCAATTTTACAGCTTTCTAAATACTT
TTCTAGGACGTGTAAAGATAAGAAAATTACTTCAAAATTTAAGAGATCAGAGCTAAAAGA
GATGTCAAAGTTATCGCAACAAGAAGGGTAAGTATTACTCCTAGTGGATTGATTTATAAC
TTAAAAGAATTAGAACTGTCAAATAGAGTTTTGAGAATTTTTTAAGACTCAACTGATTCA
TTTATAAGAGGAACATTTTAAGATGATTCCTTAGAAAATGCAAAGCATATGAAGTATGTC
TCAAGATATTTCAGGTAAAAGCTTAAATCCTTTAAAGTTTTAAACTGGGAATTTATTAAT
TTTGGATGGAGTGCTTCTCAACTTAGGAACTCATCATCTTGGTTCTTTCATGAAACTGAA
GTTCTCAAAAAATAAGATGTAATTACAAGAATTGGTGATTTTTCAGGTATTAATCCTCCA
GCTAAAAAATCTGCTAGAATTGGATAATGTTTTAGCTCAAGTACTCCCTATATCTTGAAA
GAAAGACCTAACATAGAATTCATTGATGATATTACTACACCCTCAGCAGTTTAAGAAGTT
GATGCTAATGGAAATATTTGCTACTTTAGATAAAAGAAAAAAGTTTTTACAGATGGTATT
GGAACTATTTCATAAGATCTTATAAGAAAAATATCAGATCATCTTAATGCCTTTTTTATG
TGTGCTATATAAGTAAGATATGGAGGAGCTAAAGGAGTGTTGACAATTGATTATAAAAGT
GATAAAAAAAATACAATATAGTTGAGAGAAAGTATGATAAAATATAAAATTACAGATGAA
TAAGACGAATTAATAATTGATATTCTAGATAGAAACAAATATAGATTTGGATATTTGAAT
AGGTAAGTCATTATCTTACTTAGATCACTAGGTATTGAAAACGAATAATTCATCTAAGCT
CAGCAAGAATACATAGAAGAGTTAAATAAGTCAGCATTGAAAGATGCAAGTATATTTACA
CTTTTTAACACAGATTATTCAAAGGATGGAACAAGATTATTTCCAATCACCCATCTTCTA
AGAAGTATGTAGACAAGTAGGATTGATATGGCCTAAGATATATTCTGTAAAGGAGTTATT
CATACCCTCAAAAAAAGAGGTTTTTATATTCTGAGAAAGAAGAGTAACATTTTTCTTAAA
AAGAGTGCAAGATTGATGGGTGTTATAGATGAATATAATGTGTTAGAACAAGATGAAGTT
TTTGCATATATAAGTTAGGATTCAGAAAAATCTTTCTTTTAAGTTGAGGGAGATGTAATT
GTAGTTAAAAACCCATGTTTACATCCTGGTGATATTAGAAAATTAAAAGCTGTTACTTTG
GAAACTATTTCGTAAAGATTAGGAGAAGGAAAAATAAATCCTTTTAAAAAATTAAGGAAC
ATCCTAATATTCCCTTAAAAAGGTAAAGAGCCTATCACTTCATAAATAGCAGGTTCCGAT
TTGGATGGTGATTGCTATTTTATTTGCTGGGATTAAAGATTTATTCCCTTGGAATAGAAA
GAACCTTTTAACTATGATGAAGATGATAATAGTTAAAAAAAATAAATCTCATAAGAACAG
TATGATATAGAAATCTCTAAAAAGCCTAATACTTAGTTTAAAACTAAAAATCCTGTACGA
GAAGTGATTGATGATAATGAATAAATGCTAGACTTTTTTATAGATTTTATAAATAATGAA
AATCTTGGTAAAATAGATAATTCTCATTTAGTCTTTGCAGATAAAAGTCCATTATACGCT
GAAGACCCTAAATGTTTAAAGTTGGCATCACTACATGCATAAGCTGTAGATTATGCAAAA
ACAGGTATTTCTCCTTAATTACCAAAAAACCTTGCAATAAAAGAGTACCCTGATTTTATG
GAAAAAGATGACAAACCATCTTATTAATCATAAAGCATTTTAGGTATTTTATATAGACAA
GTAAAAGACCAGTATGAAAAACACTGTAAAAACGATATAGAAGGAGATAGATCTTAAACT
TTTATTGATAATAATTTAATATTCAATCCGCCTACATTTGTTAACGAAATTGTAGATGAG
TAAGAAAATAAAACTTATCTTGAATAGGAAATTGATTTCGCTATTGAAGCAAATAATCAA
TGGAATATAGAAATAAATAATCTCAAGCAATTCTTTGGTGCTCAAAATGAGTTTGAAATT
TACACAGGTAATTTTTCCAAACTCATAAAAGTAGAGAGGAAAAAAAAGATGAGTGCAGAA
ATAGTATAGCAAAGAATCTTGTCTACATTATTAGCAATAAAAAATAGGTTTGAGCTTTTG
TTCTTTAAAAATTTAGATGAAGATAGAGATAGATTTTATGATGAAACAAACAGAAAAAAA
TATTATAGTAAAAAATGTAAAATAAGAGCTACTTTATGGTATATCATATGCTACTTAAGA
AAACCTGAACATATTGTTTAATATGCAGTAAACTTTGAGAAAGATTCTTTACTAGGACAG
ACTTTCACTTTTTTGAGTCAATAAAAATATTTTGGAGAAACAATCATAAGAGGAAATAGA
AATCCAAAAACTATTCAATTCTTCAATGAAAATAATGATTATGTTGGCTTATCATGGTTT
ATAATTAGTAATGTCCTGTTAGAAATAAAGAAAGATAATGATAACTATAAAATGAATGAA
TAAAAATAATAAAAAAGTGAATAATAAATAAAGGAATTTGAAGATTATAAAAAAAAATTC
TATTAAAATGATTTAAATGGATACCATTCTGACGAATATTTATGA


>TTHERM_00853150(gene)
ATGATTGAACAATCTATAGAAGAGGAAAAAATCATATGCTGTATAGGCTATATAAATGGA
AAGATAACTTCTAAAAACTTTACTACCTCATTATGCTTTGCATCAATATAAAAATATCTT
TAAGAGCAACAACATAGATTTAAAAGCATTAAATGTGTCTCTATTTATACTCCAAAAAAG
GAGCAATAGTAGATTGGTTTAGATACCATTGATGATGTTAAGGAAAAAATAAAAGAGATA
CAGAAATCTATTGATCATAATTATTTGAATATACCTCAACACCTGAAAGAAGAGAGATAT
AGAGTAAACTGTAATAAAATATTAATAATCCAAATTTTTTTCTAAAATATTTTTGATAGA
TAAAAGCTTAAATTTTTAGGAAGGTTAATAGTCTTTGGATAATGATGATGATAGCAATTT
ACTTGGTAGTGAATATTAGTTTTTAAAAAACTTTATTACAAAAGAAAATGATGATATTCA
TCTGAAGGAAGAAATGGCTAGCTTTAATAAAATAGAAAGGTTTTTATTTCATATACTTAC
TTACTTATTTTTTATGCTAAAACATTTTCTAAATTAATATAAAAAGCTTTTGTTAAAATG
TATTAAAGAACTCTAAAAATGAGTCTAAAATAAATACTGTAAACTAATAAAAAGATTAGT
ATGCAAGGATAAATAGCTGGATTATAATTTTAAGTGGAACGGAATAGGATTTAGAAGTTC
TGAACGATTCAAAGATTGATGTAAAGACAAAACATGAAAAATATTACTTCTTTTTAAAAA
CAAAACATAATGACAACGAAAAAAAAAATTATTTGAAAATTTGTACTGATGAATTATCGA
ATTATGCTAAGGAATAGATGAATTTTGTAAATATAAAATTGCTTCAAGTTAGTTTAGGGA
TATTTGAATTATACGGCGGTGCTTTATACTACAATTGTTAGTTTTAATTTGAAGTAATAA
GCTATTTACTGAATTTTAGTATTTAGTAATTATTTAAAATATTAGGAAAACATAGACTAT
GTAAACACAATCAGCATCTATATGTAAAATGATGAATCAGAGGTAATTATATTAAATTAA
TAATTTATGTATCCATATAAATTTAATAAAATGTTTATTATTTAAATTATTTTCTATTTA
GATTATTAGCAATAACAATATAAAATTAATATTTTTTTTTTAAGAGCAAGTAAAAATAGT
AATCGGTATCTATTGTGTTAGCATATAATGATTATTAGCTAAAAATTGAGTTTCCATATT
TATATTGCAATGAAATAAGATTTGATTAAAGAGGTAAAAATATGTATTACTTTTAATTAG
TTGTTCCTCCTAAATATTTTGTCAGAGAAAATTCAGCTAATATTTAAGAAAACTTGGATT
AAAAAAAGAACACTTGGATTAGAGTAGATAACTTCTTTGCTCATGACATCAGTAATGAGC
TTAAAAGAATAGAATTTGTAAACAATACAGTTATTTGTATTGAGATAGAAAATGAAACAG
TCAATACATTCTAAACGATACTTAAAAATTCTTTTTCAAACGTGTTTAAAGATACAGACC
CTATTCCTATTTCAAATGTGTCACAACATTTTCCTTAAGAACCTGAAAATGATTTAGACT
AATAATGGGAAAGACTTCTAAATAGATATTCATTCAATTTAAGCTATTCGATCTTAACAC
TAATATCTCACAATAAAGTAAATTAAATATTTTTGCATTTATTTGTGCAACTAAGAGGTT
ATTTATTTATTTATTTATTTATAATAATCTTAAAGCTAAGTGTCGTCAAATTAAGAGAAT
TTCTTGACTATATAGATCTTTAAATAAGAGATGGTAAATCAGAGTATATATTAGAAAAAG
GAATTTAGTATTATTACAACTAAAAGAAAGAAATTAATCGCCTCAATTTTACAGCTTTCT
AAATACTTTTCTAGGACGTGTAAAGATAAGAAGTAAAATTAATTATTCCTGTTTTTAAAT
TAATTCGTTATTTTTTTTAGAATTACTTCAAAATTTAAGAGATCAGAGCTAAAAGAGATG
TCAAAGTTATCGCAACAAGAAGGGTAAGTATTACTCCTAGTGGATTGATTTATAACTTAA
AAGAATTAGAACTGTCAAATAGAGTTTTGAGAATTTTTTAAGACTCAACTGATTCATTTA
TAAGAGGAACATTTTAAGATGATTCCTTAGAAAATGCAAAGCATATGAAGTATGTCTCAA
GATATTTCAGGTAAAAGCTTAAATCCTTTAAAGTTTTAAACTGGGAATTTATTAATTTTG
GATGGAGTGCTTCTCAACTTAGGAACTCATCATCTTGGTTCTTTCATGAAACTGAAGTTC
TCAAAAAATAAGATGTAATTACAAGAATTGGTGATTTTTCAGGTATTAATCCTCCAGCTA
AAAAATCTGCTAGAATTGGATAATGTTTTAGCTCAAGTACTCCCTATATCTTGAAAGAAA
GACCTAACATAGTAATAAAATTATTTAATATTAAAAATTTAAATATTTAATCCTTTTAAA
GGAATTCATTGATGATATTACTACACCCTCAGCAGTTTAAGAAGTTGATGCTAATGGAAA
TATTTGCTACTTTAGATAAAAGAAAAAAGTTTTTACAGATGGTATTGGAACTATTTCATA
AGATCTTATAAGAAAAATATCAGTAAAATTTAGATTAATAAAATTTGTAATCATAAATCT
CAAAATTAAATAATATTAATAGGATCATCTTAATGCCTTTTTTATGTGTGCTATATAAGT
AAGATATGGAGGAGCTAAAGGAGTGTTGACAATTGATTATAAAAGTGATAAAAAAAATAC
AATATAGTTGAGAGAAAGTATGATAAAATATAAAATTACAGATGAATAAGACGAATTAAT
AATTGATATTCTAGATAGAAACAAATATAGATTTGGATATTTGAATAGGTAAGTCATTAT
CTTACTTAGATCACTAGGTATTGAAAACGAATAATTCATCTAAGCTCAGCAAGAATACAT
AGAAGAGTTAAATAAGTCAGCATTGAAAGATGCAAGTATATTTACACTTTTTAACACAGA
TTATTCAAAGGATGGAACAAGATTATTTCCAATCACCCATCTTCTAAGAAGTATGTAGAC
AAGTAGGATTGATATGGCCTAAGATATATTCTGTAAAGGAGTTATTCATACCCTCAAAAA
AAGAGTAAATTAAATATTTAAAATATATTTTCAAAATAGATAAATTAATGAAAAGCTAAT
ATTTCAACATAAAATATTAACAAATATTTAAACAAAAAATTTCAAGTTAATACAATAAAA
ATTTTAAGTTATCCTTTCTAGTAAAAAGTAATTTTTAATTAGAAAATGCTATTAAAATAT
TTATTTTTTATACCATCACCATTTAAATAAATAATTGCTATTTAAAAATGAGAAAATTAC
CGTACTCTAAGTTAATTTTGGACCTCGAATTTTGAATTTTTTTTTACAAATTCTGATATC
AATAATAAGGGTTTAGGTTTTTAATAAACTAATAAATTATTCACAAAAATCGCAAAAACT
ATGCTAAATATGAACAGTTAATTTTTAATAATGAATAATCATAAATTTAACAAGTTATTT
AATTTTATTAAATATTTATATTCTTATATTTTTTCAATAAAGAATATTGATTAAATTATT
AAAAAATATAATTCATTTTATTAATTTTGTTTTAATATTTTTAGGGTTTTTATATTCTGA
GAAAGAAGAGTAACATTTTTCTTAAAAAGAGTGCAAGATTGATGGGTGTTATAGATGAAT
ATAATGTGTTAGAACAAGATGAAGTTTTTGCATATATAAGTTAGGATTCAGAAAAATCTT
TCTTTTAAGTTGAGGGAGATGTAATTGTAGTTAAAAACCCATGTTTACATCCTGGTGATA
TTAGAAAATTAAAAGCTGTTACTTTGGAAACTATTTCGTAAAGATTAGGAGAAGGAAAAA
TAAATCCTGTAATATTTTAAAGTTTTTATAAATTTCTAATTTATTAATTTTATGATAGTT
TAAAAAATTAAGGAACATCCTAATATTCCCTTAAAAAGGTAAAGAGCCTATCACTTCATA
AATAGCAGGTAAATTTTTTATTTTTCAAATTACTTTTTTTTAACTTAATTTATATGTAAA
AGGTTCCGATTTGGATGGTGATTGCTATTTTATTTGCTGGGATTAAAGATTTATTCCCTT
GGAATAGAAAGAACCTTTTAACTATGATGAAGATGATAATAGTTAAAAAAAATAAATCTC
ATAAGAACAGTATGATATAGAAATCTCTAAAAAGCCTAATACTTAGTTTAAAACTAAAAA
TCCTGTACGAGAAGTGATTGATGATAATGAATAAATGCTAGACTTTTTTATAGATTTTAT
AAATAATGAAAATCTTGGTAAAATAGATAATTCTCATTTAGTCTTTGCAGATAAAAGTCC
ATTATACGCTGAAGACCCTAAATGTTTAAAGTTGGCATCACTACATGCATAAGCTGTAGA
TTATGCAAAAACAGGTATTTCTCCTTAATTACCAAAAAACCTTGCAATAAAAGAGTACCC
TGATTTTATGGAAAAAGATGACAAACCATCTTATTAATCATAAAGCATTTTAGGTAAAAT
ATTTAGTGAGTTAATTTAATTTGATAATTTTTAATCATCATTTAGGTATTTTATATAGAC
AAGTAAAAGACCAGTATGAAAAACACTGTAAAAACGATATAGAAGGAGATAGATCTTAAA
CTTTTATTGATAATAATTTAATATTCAATCCGCCTACATTTGTTAACGAAATTGTAGATG
AGTAAGAAAATAAAACTTATCTTGAATAGGAAATTGATTTCGTAAAATTTTCTTTTTCAA
AAATTTATTCTTAGTAAAAATATATATTTATTTATAATTTGATAGGCTATTGAAGCAAAT
AATCAATGGAATATAGAAATAAATAATCTCAAGCAATTCTTTGGTGCTCAAAATGAGTTT
GAAATTTACACAGGTAATTTTTCCAAACTCATAAAAGTAGAGAGGAAAAAAAAGATGAGT
GCAGAAATAGTATAGCAAAGAATCTTGTCTACATTATTAGCAATAAAAAATAGGTTTGAG
CTTTTGTTCTTTAAAAATTTAGATGAAGATAGAGATAGATTTTATGATGAAACAAACAGA
AAAAAATATTATAGTAAAAAATGTAAAATAAGAGCTACTTTATGGTATATCATATGCTAC
TTAAGAAAACCTGAACATATTGTTTAATATGCAGTAAACTTTGAGAAAGATTCTTTACTA
GGACAGACTTTCACTTTTTTGAGTCAATAAAAATATTTTGGAGAAACAATCATAAGAGGA
AATAGAAATCCAAAAACTATTCAATTCTTCAATGAAAATAATGATTATGTTGGCTTATCA
TGGTTTATAATTAGTAATGTCCTGTTAGAAATAAAGAAAGATAATGATAACTATAAAATG
AATGAATAAAAATAATAAAAAAGTGAATAATAAATAAAGGAATTTGAAGATTATAAAAAA
AAATTCTATTAAAATGATTTAAATGGATACCATTCTGACGAATATTTATGA


>TTHERM_00853150(protein)
MIEQSIEEEKIICCIGYINGKITSKNFTTSLCFASIQKYLQEQQHRFKSIKCVSIYTPKK
EQQQIGLDTIDDVKEKIKEIQKSIDHNYLNIPQHLKEERYRVNYKSLNFQEGQQSLDNDD
DSNLLGSEYQFLKNFITKENDDIHLKEEMASFNKIESFCQNVLKNSKNESKINTVNQQKD
QYARINSWIIILSGTEQDLEVLNDSKIDVKTKHEKYYFFLKTKHNDNEKKNYLKICTDEL
SNYAKEQMNFVNIKLLQVSLGIFELYGGALYYNCQFQFEENIDYVNTISIYMQNDESESK
QKQQSVSIVLAYNDYQLKIEFPYLYCNEIRFDQRGKNMYYFQLVVPPKYFVRENSANIQE
NLDQKKNTWIRVDNFFAHDISNELKRIEFVNNTVICIEIENETVNTFQTILKNSFSNVFK
DTDPIPISNVSQHFPQEPENDLDQQWERLLNRYSFNLSYSILTLISHNKLSVVKLREFLD
YIDLQIRDGKSEYILEKGIQYYYNQKKEINRLNFTAFQILFQDVQRQENYFKIQEIRAKR
DVKVIATRRVSITPSGLIYNLKELELSNRVLRIFQDSTDSFIRGTFQDDSLENAKHMKYV
SRYFRQKLKSFKVLNWEFINFGWSASQLRNSSSWFFHETEVLKKQDVITRIGDFSGINPP
AKKSARIGQCFSSSTPYILKERPNIEFIDDITTPSAVQEVDANGNICYFRQKKKVFTDGI
GTISQDLIRKISDHLNAFFMCAIQVRYGGAKGVLTIDYKSDKKNTIQLRESMIKYKITDE
QDELIIDILDRNKYRFGYLNRQVIILLRSLGIENEQFIQAQQEYIEELNKSALKDASIFT
LFNTDYSKDGTRLFPITHLLRSMQTSRIDMAQDIFCKGVIHTLKKRGFYILRKKSNIFLK
KSARLMGVIDEYNVLEQDEVFAYISQDSEKSFFQVEGDVIVVKNPCLHPGDIRKLKAVTL
ETISQRLGEGKINPFKKLRNILIFPQKGKEPITSQIAGSDLDGDCYFICWDQRFIPLEQK
EPFNYDEDDNSQKKQISQEQYDIEISKKPNTQFKTKNPVREVIDDNEQMLDFFIDFINNE
NLGKIDNSHLVFADKSPLYAEDPKCLKLASLHAQAVDYAKTGISPQLPKNLAIKEYPDFM
EKDDKPSYQSQSILGILYRQVKDQYEKHCKNDIEGDRSQTFIDNNLIFNPPTFVNEIVDE
QENKTYLEQEIDFAIEANNQWNIEINNLKQFFGAQNEFEIYTGNFSKLIKVERKKKMSAE
IVQQRILSTLLAIKNRFELLFFKNLDEDRDRFYDETNRKKYYSKKCKIRATLWYIICYLR
KPEHIVQYAVNFEKDSLLGQTFTFLSQQKYFGETIIRGNRNPKTIQFFNENNDYVGLSWF
IISNVLLEIKKDNDNYKMNEQKQQKSEQQIKEFEDYKKKFYQNDLNGYHSDEYL