Identifiers and Description

Gene Model Identifier

TTHERM_00857860

Standard Name

MRNC50 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt09050 | 152.m00070

Description

MORN motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_07182.1 9.997093137033517e-262
Description: hypothetical protein (585 aa)
Oxytricha Contig13677.0.1.g35 3.999925618735366e-62
Description: MORN repeat
Stentor Coeruleus SteCoe_23375 8.75651076269652e-27
Description: None
DictyBase DDB_G0349488 5.000468829272308e-18
Description: DDB_G0349488 on chromosome: 2 position 6912714 to 6914186
WormBase WBGene00002179 0.0000007001298633766835
Description: locus:jph-1 status:Confirmed UniProt:Q22667 protein_id:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00857860(coding)
ATGAATAATTCAAAGTCAAACGAATCAAATTAGCTTTGTTGTTCAAAACACAACCAAAAA
TAAATTCGCTTTATTTGTTGTTTTGATGGTTGTAATTTTGGTAATTTAATATGCGATACT
TGTCTGACAAATGACCCAAGACATATGTAACAACACAAAAGTTATGTTTCAGACACTAAT
CACTTTTTTGCTACTTAAACTAAAATGACATAAAAATTGCTTCCTTCTATAGCCGAATCT
GTTTAAGATATAGATAAAAATTTTAAGGAATATAATCAGCATTGCGACAATGAAGTGGCA
GAAATAGACAAAGATTTTGCAGAAATTTTTAAAACATTCTTTAATATTTCTGAAGCTGCT
AAAAATTTCTTGAAGGATTAAATTAGAACTGAGGGAAAAAAGTTTTAGCCAAGATTGCAG
GATCTATAAAATAAATTACAGGAATTAAACTAAACAAAAAAAAAGGATACTAACATTTTC
AATATGATTTTTTCTAGGGATAATGATGAAGTTACAGCATCATCATAAGATGAATTAGTT
GCAAAATTAATAAAGAAAAATGGACCATTAAACCTGATTAGAGCTGAATCGTTTGCTCTT
TCTTAAGAATTAAGCTAAATTAAATCAAAGAAAGTTAACTACAAGCATTTGGATGAATCA
AAGAAGTTATTTGAGCAAATAAAAGATGCCTTTGAAAACCAAACAAAAGATATGTATAGA
AAATTCAAAGCACTCTTAGAAGGAGCTGACAATGAAGATTTAAGATAAAGCATATTTGCA
GGAATTAAATCAACTGTTTCTCTCTCTAATAGCATGATTTTAAGCAAGAAGGCTTCTGTT
GTCAGCATTGATTTATCATCTTCATCATCTTCAAATCCCCTAAAAAGATCTATCACTTTA
ACATCTGAGGATAATGAAAAGAAACCTGCTAGATAATTAAAAAAAGTAGCCCAATTCCCT
AGCTTATCAAATAAAAATGTTTTAGAAGCAATCAGAATAAATGGCTCTTTTAATTACAGA
ATAGAAGATTCTTACTTAAATAATTAACCAGAATAAGGTCCATTCGAATTCGAAGATGGT
TCAATATATTATGGACATATTTAGGATTCCAAAAGAAATGGAAGAGGAAAATAGATGTTT
TAAGATGGAGCTTATTATGAAGGATTTTGGAAAGATGATATTCCTTTCGGCATGGGAAGA
ATTATAAGAAATAATGGAGATGTCTATTAAGGTTAAATTAATAACTTCAAAGCCCATGGC
AAAGGTGTGTTCAAGACACTTAAAGGAGAATATATGTACAATGGAGATTGGTTAGAAGAT
TTAAAGCATGGAAGAGGTGATGAAGTCATTCAAGGCAAATACTTATATAGTGGAGACTTT
TCATATGGTAAAAAACATGGAAATGGAGAAATTAAATTCGTCGATGGCACAATCTATTTA
GGTGAATTTAAAGAAGGAGAGATAACAGGAGAAGGACAATTTATTTATCCAAATGGTGAA
AAATATGTTGGCTGTGTTAAAGATGGTTAGAAATACGGAAAAGGATCTTATGTTTGGCCA
GATGGCAGAAATTATGATGGTACTTACATGAATAATTTGCCTCATGGTAAAGGAATGTTT
ATATGGCCTGATGGATATATATATAACGGTAATTGGGTAAATGGTGTGCAGCATGGATAA
GGATTAGAAATAGATCCAGAAGGTAATGAAAAAGAAGGAGTCTGGGAAAATGGTGTCTGG
AAAAATTGGGTTTGA


>TTHERM_00857860(gene)
ATGAATAATTCAAAGTCAAACGAATCAAATTAGCTTTGTTGTTCAAAACACAACCAAAAA
TAAATTCGCTTTATTTGTTGTTTTGATGGTTGTAATTTTGGTAATTTAATATGCGATACT
TGTCTGACAAATGACCCAAGACATATGTAACAACACAAAAGTTATGTTTCAGACACTAAT
CACTTTTTTGCTACTTAAACTAAAATGACATAAAAATTGCTTCCTTCTATAGCCGAATCT
GTTTAAGATATAGATAAAAATTTTAAGGAATATAATCAGCATTGCGACAATGAAGTGGCA
GAAATAGACAAAGATTTTGCAGAAATTTTTAAAACATTCTTTAATATTTCTGAAGCTGCT
AAAAATTTCTTGAAGGATTAAATTAGAAGTAAAAGACAATTATTTAAATTCATTTTCTTT
AAAGTTATTGGCTTTATTAAATTATAATATGAATCAAAAAAAAAAATATGAAAGAACAAA
AAAAATTTAATTATTATTTCTAAATTACAAAAAGCTGAGGGAAAAAAGTTTTAGCCAAGA
TTGCAGGATCTATAAAATAAATTACAGGAATTAAACTAAACAAAAAAAAAGGATACTAAC
ATTTTCAATATGATTTTTTCTAGGGATAATGATGAAGTTACAGCATCATCATAAGATGAA
TTAGTTGCAAAATTAATAAAGAAAAATGGACCATTAAACCTGATTAGAGCTGAATCGTTT
GCTCTTTCTTAAGAATTAAGCTAAATTAAATCAAAGAAAGTTAACTACAAGCATTTGGAT
GAATCAAAGAAGTTATTTGAGCAAATAAAAGATGCCTTTGAAAACCAAACAAAAGATATG
TATAGAAAATTCAAAGCACTCTTAGAAGGAGCTGACAATGAAGATTTAAGATAAAGCATA
TTTGCAGGAATTAAATCAACTGTTTCTCTCTCTAATAGCATGATTTTAAGCAAGAAGGCT
TCTGTTGTCAGCATTGATTTATCATCTTCATCATCTTCAAATCCCCTAAAAAGATCTATC
ACTTTAACATCTGAGGGTAAATTTTTAATAAATAGTGATTTATTTTAAATATTTTAAAAG
ATAATGAAAAGAAACCTGCTAGATAATTAAAAAAAGTAGCCCAATTCCCTAGCTTATCAA
ATAAAAATGTTTTAGAAGCAATCAGAATAAATGGCTCTTTTAATTACAGAATAGAAGATT
CTTACTTAAATAATTAACCAGAATAAGGTCCATTCGAATTCGAAGATGGTTCAATATATT
ATGGACATATTTAGGATTCCAAAAGAAATGGAAGAGGTGAATTGATTCACTATTTTTAAT
TTTATAACTGATCTAAATTTTTTCATAATTGTAGGAAAATAGATGTTTTAAGATGGAGCT
TATTATGAAGGATTTTGGAAAGATGATATTCCTTTCGGCATGGGAAGAATTATAAGAAAT
AATGGAGATGTCTATTAAGGTTAAATTAATAACTTCAAAGCCCATGGCAAAGGTGTGTTC
AAGACACTTAAAGGAGAATATATGTACAATGGAGATTGGTTAGAAGATTTAAAGCATGGA
AGAGGTGATGAAGTCATTCAAGGCAAATACTTATATAGTGGAGACTTTTCATATGGTAAA
AAACATGGAAATGGAGAAATTAAATTCGTCGATGGCACAATCTATTTAGGTGAATTTAAA
GAAGGAGAGATAACAGGAGAAGGACAAGTAAAAAAAATTAATCAATAAAAAATTTTCATA
TAATTTTAATATAGTTTATTTATCCAAATGGTGAAAAATATGTTGGCTGTGTTAAAGATG
GTTAGAAATACGGAAAAGGATCTTATGTTTGGCCAGATGGCAGAAATTATGATGGTACTT
ACATGAATAATTTGCCTCATGGTAAAGGAATGTTTATATGGTAATTTTTATTTATAATTA
TTTTAACATTAATAAAAGCTCATAACTAATACATACTTTTAATCTATTTTAAAGCATGAT
AATTTTTTAGTAATTTATTTATGTGTTTAATAATTATTATTGCATTTAAAAGGCCTGATG
GATATATATATAACGGTAATTGGGTAAATGGTGTGCAGCATGGATAAGGATTAGAAATAG
ATCCAGAAGGTAATGAAAAAGAAGGAGTCTGGGAAAATGGTGTCTGGAAAAATTGGGTTT
GA


>TTHERM_00857860(protein)
MNNSKSNESNQLCCSKHNQKQIRFICCFDGCNFGNLICDTCLTNDPRHMQQHKSYVSDTN
HFFATQTKMTQKLLPSIAESVQDIDKNFKEYNQHCDNEVAEIDKDFAEIFKTFFNISEAA
KNFLKDQIRTEGKKFQPRLQDLQNKLQELNQTKKKDTNIFNMIFSRDNDEVTASSQDELV
AKLIKKNGPLNLIRAESFALSQELSQIKSKKVNYKHLDESKKLFEQIKDAFENQTKDMYR
KFKALLEGADNEDLRQSIFAGIKSTVSLSNSMILSKKASVVSIDLSSSSSSNPLKRSITL
TSEDNEKKPARQLKKVAQFPSLSNKNVLEAIRINGSFNYRIEDSYLNNQPEQGPFEFEDG
SIYYGHIQDSKRNGRGKQMFQDGAYYEGFWKDDIPFGMGRIIRNNGDVYQGQINNFKAHG
KGVFKTLKGEYMYNGDWLEDLKHGRGDEVIQGKYLYSGDFSYGKKHGNGEIKFVDGTIYL
GEFKEGEITGEGQFIYPNGEKYVGCVKDGQKYGKGSYVWPDGRNYDGTYMNNLPHGKGMF
IWPDGYIYNGNWVNGVQHGQGLEIDPEGNEKEGVWENGVWKNWV