Identifiers and Description

Gene Model Identifier

TTHERM_00857880

Standard Name

RRM58 (RNA recognition motif-containing protein 58)

Aliases

PreTt09052 | 152.m00072

Description

RRM58 polyadenylate-binding protein; polyadenylate-binding protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( PF08777 ) RNA binding motif
  • ( TIGR01622 ) splicing factor, CC1-like family
  • ( TIGR01628 ) polyadenylate binding protein, human types
  • ( TIGR01659 ) sex-lethal family splicing factor
  • ( TIGR01661 ) ELAV/HuD family splicing factor

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_07184.1 1.9998745702418095e-48
Description: hypothetical protein (1214 aa)
Oxytricha Contig1956.0.g14 2.0004286606204839e-16
Description: RNA recognition motif_ (a_k_a_ RRM, RBD, or RNP domain)
WormBase WBGene00004701 0.0000000029989608248573072
Description: locus:rsp-4 Probable splicing factor, arginine/serine-rich 4 status:Confirmed UniProt:Q09511 protein_id:CCD68735.1
SGD YGR159C 0.0000008998839737394744
Description: NSR1 Nucleolar protein that binds nuclear localization sequences, required for pre-rRNA processing and ribosome biogenesis
DictyBase DDB_G0277353 0.000004000864880866421
Description: DDB_G0277353 on chromosome: 2 position 7808700 to 7811174

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00857880(coding)
ATGTTTGTAGAAAGTGAAGTTTTTACTGAAAATACTTAATCAAACTCACAATTTATAGCA
AATAATTTCTAGTAAATGGTGAAAGATGAATCTAAAATTAGCAATATAAAAGATACTTAT
GTAAAAGAAAATGATATAAACTCATCAAGAATTAACGCTGATGAAGATAATAGATAATAG
TCTATGTCTTCTAAATTCTCCAATCGCAATACATCTGCTTCTTCAAGAAGATAATCTTCT
TAAGTAAGCGCTCCTAGGTCTTCTAGATCTTCTTCTTCTGGATCTTCCTGCTCTTCCTCA
TCATCATAATCTTCTTCATCATCATAAAGGTCTCGATCATCTTCTTCATCTTCCTCCTAA
ACATATCGCACATCAAAAATGAGTAAAAGCTCAAAGATTTAGGATAAAAGAGCAACTAGA
AATGAAAATGAGTCTTAAAATAGCAAATGCTTGTACATAGCGAATTTAAGTGAGAAAGTG
ACTGAATCAAATTTAAAGAAACTTTTTGAAGAGTATGGAGAAATAGATTATGTAAATATA
TGCTATAAACCTTACAGTTAGTAATAACAGGGTATTAAAATACCTGCTGGATATGCCTTT
ATAAAATATTACAAGGAGAAAGATGCTTAAAGAGCATTAAATCACCTCGATGAAACAAAT
TTAAAAGGAAAAAAAATAAAAATTGAATATGCAAAAAGAGAGAAGCCCAGATAGTCAAAG
GATGGACCATACCATAAAATTGGAAATGTTTATAATAAAAAATAATCAGATAATTAAACA
GAGTTAAATAAATGTGATAAGATGAGTAAAAAGGATGTTCAATATTTTTCGAATTATAAC
CCTTCTGAATAAAATAAGTATAAAAGTCAAAGGCACTACATAAAGGATAAATAATCATCC
CAAAATTTATTAAAGAAAACTAATTCTGAATTTGTTGATAATAGATAGAACCTGACGATG
GATTAATAAGATTGCTTTGCAAATTAAGATTCCTACAGAAATAACTAAAAAGCAAACACA
TAAGTTAAATCTAGAAGCCGCAGCAGAAGCAGAACTTTAAGTGATAAAGTTATTTTGATT
ATGGACTTCATGATATCTAAAAGCGATAATAAGAACTAACATTAAACAATCGATTAGCAT
ACTGCTACTGTTAAAGAAGAAGATCAAAAAGTGCTTGATGAAGCCACTCTCTAGCATATT
ATGAATAAAAATGCAAATTAATAATAAATAAGCTCAATTTATGAAAATCAATCTAAAAAT
ATACGCCAAAAAACTGTTTATTCTGAAAAAAGGTAGATGGATTAGGTTAACAAAGGAAGC
TGTCTCTATATTTCGAATTTAAGCCATAAAGTGACTGATTAGCAGCTAAAGAAGATCTTT
AGCACATATGGAAGAGTTGAATATGCAAATATTTGTTACGAGCCATATAGTTAGCAGTAA
AGAGGATAAAAAATCCCTAGAGGAATAGGATTTGTCAAATACGCTAGGAATTCAGATGCT
TTGAAAGCGATTGAAGAGCTTGATGGAAAAATGATAAAAAATAAAGAAATTAAAATAATG
CTTTCTAAAAGAGATGAGCCAAGAGTTTCGCACAAAGGACCCTACTTTGGCAAAAGCCCT
AAAAAAGATAAAAAAGACTCAGATAGCAAGAAAGAATCAAAAAGGATTTAAAAGTAATCT
TCTTATTAATCCCAAACTTCAGAAGAAAATAATTCGATTGAAAGACATAGATCTATTAGC
AGGGAATCATCTGAGTCTAATGGGGATTTGACTTTCTAATAAAAATAAAAAAACTAAGCT
AAAACACATTAAGGAATAATAGATTAAGAATAATTGAATCTGAAAAATAAACAAAAGCAT
CAAAGCGATAGTTAAAATATATTATATAATGGTAGATCTACTCGCCATTAAAATAATAAA
TAAAAAAATTAAAATGATGAAAAGGACGATTAACGCATCCATGAAGAGCTAAATAAATAG
GTTAACCACTTCCAAACTTCAATATAAAATGAAAAATAAATGAATGTGTAAAATAGATCT
AGATCAAGATCTAATGAAAACTACAAAGAAAAGTAGTATAAATCAAACCAAAAGTAAACA
AGGTATAATCGTTTTAAATAGCACGGATAAAGATCTTCATCTACTTCTAACAACACATCA
TAATCCTCTTCTTCTTCGCATTCATCGTCATCATCATCTTCTTCTCCCTCATCATAACAA
TCTAGTCCTAGTTCTTCACCTTCTTAATTTTCTCGTAAAAAAAAAAAGTAGAGTGTAAGA
AAGTATAAAAATGATCAATCTTCTTAAAACAATAACAAAAGATCCAAAAAAAACTCAAAA
CAATATCGATAAAGGTCTTCATCATCTTCTTCATAATCTAACAACTCTACCTAATAATAA
AATAAAAATTCAATTAGAATAAGAAATTGA


>TTHERM_00857880(gene)
ATGTTTGTAGAAAGTGAAGTTTTTACTGAAAATACTTAATCAAACTCACAATTTATAGCA
AATAATTTCTAGTAAATGGTGAAAGATGAATCTAAAATTAGCAATATAAAAGATACTTAT
GTAAAAGAAAATGATATAAACTCATCAAGAATTAACGCTGATGAAGATAATAGATAATAG
TCTATGTCTTCTAAATTCTCCAATCGCAATACATCTGCTTCTTCAAGAAGATAATCTTCT
TAAGTAAGCGCTCCTAGGTCTTCTAGATCTTCTTCTTCTGGATCTTCCTGCTCTTCCTCA
TCATCATAATCTTCTTCATCATCATAAAGGTCTCGATCATCTTCTTCATCTTCCTCCTAA
ACATATCGCACATCAAAAATGAGTAAAAGCTCAAAGATTTAGGATAAAAGAGCAACTAGA
AATGAAAATGAGTCTTAAAATAGTATAAATTTATTAAATTTAGTTTGATTATGCTATTAA
AAATCCATTAAAAATATCATCAAAAATATTCTCAAAAAGGCAAATGCTTGTACATAGCGA
ATTTAAGTGAGAAAGTGACTGAATCAAATTTAAAGAAACTTTTTGAAGAGTATGGAGAAA
TAGATTATGTAAATATATGCTATAAACCTTACAGTTAGTAATAACAGGGTATTAAAATAC
CTGCTGGATATGCCTTTATAAAATATTACAAGGAGAAAGATGCTTAAAGAGCATTAAATC
ACCTCGATGAAACAAATTTAAAAGGAAAAAAAATAAAAATTGAATATGCAAAAAGAGAGA
AGCCCAGATAGTCAAAGGATGGACCATACCATAAAATTGGAAATGTTTATAATAAAAAAT
AATCGTAAGAATATTAATTAAATATTTAATTTTAAAATAATTTATTATTGAACCAGTTAA
AAAAGGAAAAGAAGTTAATCATTAGAGCATATTAAAGATAAATTTTCTTAGAAAAATAAA
TATATTAGAGATAATTAAACAGAGTTAAATAAATGTGATAAGATGAGTAAAAAGGATGTT
CAATATTTTTCGAATTATAACCCTTCTGAATAAAATAAGTATAAAAGTCAAAGGCACTAC
ATAAAGGATAAATAATCATCCCAAAATTTATTAAAGAAAACTAATTCTGAATTTGTTGAT
AATAGATAGAACCTGACGATGGATTAATAAGATTGCTTTGCAAATTAAGATTCCTACAGA
AATAACTAAAAAGCAAACACATAAGTTAAATCTAGAAGCCGCAGCAGAAGCAGAAGTAAT
TCTATGAGGAATAAATACTCGTGAGAGCATAAAACTATTATAACATATTTTGTTTATTTT
ACTAATTTAAAAACAATATTCTACCTTTTTGTAAATGAAATTTTAAGAATGTCCTATTTT
AATAGCAGTAAAAGCATATTAAATAATCTTCACAAACAAAAACCCTCTTCTATCAAAGAA
AGATTGATAATTAATTAATTATAAAAACTAGAAATTATTTAGTCTTAAAACAATGTTTTC
TTGAGAAAAAAATTATAAATCTTAGGTGTAAAAAGACTTAAATAAAAATAAAATATTGAT
CTCCCATTTTTTTATTAAATTTATTAAAAAATTTACTAATTTACTCTATTTTATTTATCT
GGGACTCTATTTATTGCAGCTAGCTAGCTGAAAATTTAAATAATTTTGATCATAGATTAT
AAAGACTGATTTTGTAAATTAAATGAATTAGATTGATTATTAAAAACTTATATAGCTATG
ATGAAATATAAAATTTTTTAAATGACGAAAATTACGTGTAAAAAATATTATATTTTTTTG
AGTAATAATTGAAACATAATACATTTTTTTCAATTTTATAAATAGATCAATGAAAAAACA
CAGTTGTTAATGTGAAAAAGTCTAGTTTTGAATTTCAGGTAATTTAATAGAAGAATGTAT
TAAAATAGTTATTTAGTTTGTAAAAAATAGTTATTCTATTTTGAGACTTGTAAGCCTCAT
GCTATATTTATGAAGGAAAGGATATATGAAGCAAAAGAAAAATCTAAATAAATAAATACG
CATAAATTATAAGATTAATCAAAAAGGCAAGAAAAATAACATTTACTCTCAAACAAAGTC
TTTTAGCTAATAAAAAGATAATAATGTGCAAAAAAAAGTGATATTCTTTAATTATATTGC
ATATTTTATTAAAAGAATTAGAAGAACAAAATTTTTATAGCAGCTGGAGCTAATTCAAAT
TTTAGCTTTAAGTGATAAAGTTATTTTGATTATGGACTTCATGATATCTAAAAGCGATAA
TAAGAACTAACATTGTAAAATCATTTTTATAAATTCATTTTAGACTTTTATATTATTTGT
TGTTTCAAATTTAGAACAGCACTAATTTTGCAAGATAATTTAAAATTATCAATTTGTGCC
TTTAAAAAAGAAAAGTAGAAAGACGGAAATACTTTAATTTAAGCTTTGCCTATTAGATTT
CTCTTAAATTTTTTTTATATAAATAAGAAACAATCGATTAGCATACTGCTACTGTTAAAG
AAGAAGATCAAAAAGTGCTTGATGAAGCCACTCTCTAGCATATTATGAATAAAAATGCAA
ATTAATAATAAATAAGCTCAATTTATGAAAATCAATCTAAAAATATACGCCAAAAAACTG
TTTATTCTGAAAAAAGGTAGATGGATTAGGTTAACAAAGGTAGATTTCTTACAAATTTTC
ATATAAATTACCTTAAATTTACTCATAATTGCTTAATAATTAACAGGAAGCTGTCTCTAT
ATTTCGAATTTAAGCCATAAAGTGACTGATTAGCAGCTAAAGAAGATCTTTAGCACATAT
GGAAGAGTTGAATATGCAAATATTTGTTACGAGCCATATAGTTAGCAGTAAAGAGGATAA
AAAATCCCTAGAGGAATAGGATTTGTCAAATACGCTAGGAATTCAGATGCTTTGAAAGCG
ATTGAAGAGCTTGATGGAAAAATGATAAAAAATAAAGAAATTAAAATAATGCTTTCTAAA
AGAGATGAGCCAAGAGTTTCGCACAAAGGACCCTACTTTGGCAAAAGCCCTAAAAAGTAT
TAAATTTTTTCAATTAATTAAATAAATAAAATAAAAATAAGGTTAAATCATTGTTAAAAT
ATCATAGTTTAAAATAATTTTAAAATTAAAATAATACTTATAAAATTGTTTGAAATAATA
AAAAAACAAATATCTTATGACAAACCAAGCAAAAAATAATAATTCGCCAAAGTATTATAT
TTGTTTTGTTAAATGATTACTTCAATAATTATTAAGAAAATTAATTAATTTTTTTTAAAG
TCAAATAATGAACAAAAAATTAATTAAAAAATTTGAAAATAAATAAAAGAAAGCAAAAAT
CATCTTCTTTTGTTAGTTTTTCTTTAAAATTCACTATAATTAATTTAATTAACTAACTTG
TTATCAAAGCGCATTCTTTCTTTTTATAAACCAAAACTATAGCTTGATATTATTTTTAAT
ATTACTAATTTTAATTAAGAGATAAAAAAGACTCAGATAGCAAGAAAGAATCAAAAAGGA
TTTAAAAGTAATCTTCTTATTAATCCCAAACTTCAGAAGAAAATAATTCGATTGAAAGAC
ATAGATCTATTAGCAGGGAATCATCTGAGTCTAATGGGGATTTGACTTTCTAATAAAAAT
AAAAAAACTAAGCTAAAACACATTAAGGAATAATAGATTAAGAATAATTGAATCTGAAAA
ATAAACAAAAGCATCAAAGCGATAGTTAAAATATATTATATAATGGTAGATCTACTCGCC
ATTAAAATAATAAATAAAAAAATTAAAATGATGAAAAGGACGATTAACGCATCCATGAAG
AGCTAAATAAATAGGTTAACCACTTCCAAACTTCAATATAAAATGAAAAATAAATGAATG
TGTAAAATAGATCTAGATCAAGATCTAATGAAAACTACAAAGAAAAGTAGTATAAATCAA
ACCAAAAGTAAACAAGGTATAATCGTTTTAAATAGCACGGATAAAGATCTTCATCTACTT
CTAACAACACATCATAATCCTCTTCTTCTTCGCATTCATCGTCATCATCATCTTCTTCTC
CCTCATCATAACAATCTAGTCCTAGTTCTTCACCTTCTTAATTTTCTCGTAAAAAAAAAA
AGTAGAGTGTAAGAAAGTATAAAAATGATCAATCTTCTTAAAACAATAACAAAAGATCCA
AAAAAAACTCAAAACAATATCGATAAAGGTCTTCATCATCTTCTTCATAATCTAACAACT
CTACCTAATAATAAAATAAAAATTCAATTAGAATAAGAAATTGA


>TTHERM_00857880(protein)
MFVESEVFTENTQSNSQFIANNFQQMVKDESKISNIKDTYVKENDINSSRINADEDNRQQ
SMSSKFSNRNTSASSRRQSSQVSAPRSSRSSSSGSSCSSSSSQSSSSSQRSRSSSSSSSQ
TYRTSKMSKSSKIQDKRATRNENESQNSKCLYIANLSEKVTESNLKKLFEEYGEIDYVNI
CYKPYSQQQQGIKIPAGYAFIKYYKEKDAQRALNHLDETNLKGKKIKIEYAKREKPRQSK
DGPYHKIGNVYNKKQSDNQTELNKCDKMSKKDVQYFSNYNPSEQNKYKSQRHYIKDKQSS
QNLLKKTNSEFVDNRQNLTMDQQDCFANQDSYRNNQKANTQVKSRSRSRSRTLSDKVILI
MDFMISKSDNKNQHQTIDQHTATVKEEDQKVLDEATLQHIMNKNANQQQISSIYENQSKN
IRQKTVYSEKRQMDQVNKGSCLYISNLSHKVTDQQLKKIFSTYGRVEYANICYEPYSQQQ
RGQKIPRGIGFVKYARNSDALKAIEELDGKMIKNKEIKIMLSKRDEPRVSHKGPYFGKSP
KKDKKDSDSKKESKRIQKQSSYQSQTSEENNSIERHRSISRESSESNGDLTFQQKQKNQA
KTHQGIIDQEQLNLKNKQKHQSDSQNILYNGRSTRHQNNKQKNQNDEKDDQRIHEELNKQ
VNHFQTSIQNEKQMNVQNRSRSRSNENYKEKQYKSNQKQTRYNRFKQHGQRSSSTSNNTS
QSSSSSHSSSSSSSSPSSQQSSPSSSPSQFSRKKKKQSVRKYKNDQSSQNNNKRSKKNSK
QYRQRSSSSSSQSNNSTQQQNKNSIRIRN