Identifiers and Description

Gene Model Identifier

TTHERM_00859260

Standard Name

EF1BL1 (Elongation Factor 1 Beta Like 1)

Aliases

PreTt09088 | 152.m00108

Description

EF-1 guanine nucleotide exchange domain protein; EF-1 guanine nucleotide exchange domain containing protein; involved in guanine nucleotide exchange to activate EF1A from its inactive (GDP) form to its active (GTP) form so that it can readily associate with an aminoacyl-tRNA

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00736 ) EF-1 guanine nucleotide exchange domain
  • ( TIGR00489 ) translation elongation factor aEF-1 beta

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_07206.1 2.0005752503420762e-105
Description: EF-1 guanine nucleotide exchange domain-containing protein (226 aa)
Oxytricha Contig19220.0.g56 9.001422350855153e-28
Description: EF-1 guanine nucleotide exchange domain
WormBase WBGene00018846 3.0002687256732656e-20
Description: locus:eef-1B.1 Probable elongation factor 1-beta/1-delta 1 status:Confirmed UniProt:P34460 protein_id:CCD63459.1
DictyBase DDB_G0284035 0.000000000000001999258566166494
Description: efa1B on chromosome: 4 position 1535647 to 1536451
SGD YAL003W 0.0000000000000030004923591262316
Description: EFB1 Translation elongation factor 1 beta; stimulates nucleotide exchange to regenerate EF-1 alpha-GTP for the next elongation cycle; part of the EF-1 complex, which facilitates binding of aminoacyl-tRNA to the ribosomal A site
Stentor Coeruleus SteCoe_13681 0.000000000013887943864964021
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00859260(coding)
ATGAATAAAGAAATAGTATATTTATAATATGAGATGGATTGGTTGCTTGGTTGCTTGTTT
AATAGATTGATAGAAACTTAAAAAACTATAAATTTCTTTTTAAGTCAATTCCTTCTTTTT
TTCCATTCGATAAACAAATATCTTTTTTTTTTTGAGACAATCAAAAAAATATATATATTT
TTGTTTGTTTGCTTTTTTAGATTATTTTTAGATTTGCATTTGTACGTATTTTTAATATAC
ATTAAAAAATAAATTCTCTGGGAAAAGATATATAAAGTAAATTTAATAAATTATTATCAA
AAACTAAAAAACAAAAAGCAAAAAACAAACCAATTCTCTAAAATGACTTTCTCTGCTACC
GACCTCCCCACCCTCGAAAAGCACTTAGCTGCCCACACCTACCTTTCCGGTACTGATAAG
CCCGCTAAGATTGATGCTTAAATTGCCACCGAACTCAAGGATAAGAAGGTTGCCCTCAAC
GCCGCCACCCACCCCAACGTCTATGCCTGGTTCAGCTTCATCGGTTTATTCACCCCCGAA
GCTCAAAATACCTGGGCTGATGTTGCTCCCGTCGCCGTCCCCGTTGCTGCCAAGAAGGAA
GCCAAGAAGGAAACCAAGACCGACGATGTCGATCTTTTCGGTGATGATGATGAAGAAGAT
GCTGAAGCTGAAGCTTTGAGAGAAAAGAAGAGACTCGAAGCCGTCGCTGCCAAGGAAGCT
AGAGATGGTAAGAAGAAGAAGGCTATTGCCAAGACTATCCTCGTCTTCAACGTCAAGGTC
TTCGAAGCTGAATAAGACTTAGACGCTTTGGCCAAGAAGATCTACGAAACCATCCAACTC
GACGGTTTGGTCTGGAACAAGGAACACAAGAAGATCCCCGTTGCCTTCGGTGTCTTCATG
CTCCAAATGGGTTGCATCATTGAAGACGATAAGGTCAACACCGACAGTATCTTCGAACCC
ATCCAATCTTGGGAAGATGAAGTCCAATCCGTTGATGTTGAAACCATGCAAAAACTTTGA


>TTHERM_00859260(gene)
ATGAATAAAGAAATAGTATATTTATAATATGAGATGGATTGGTTGCTTGGTTGCTTGTTT
AATAGATTGATAGAAACTTAAAAAACTATAAATTTCTTTTTAAGTCAATTCCTTCTTTTT
TTCCATTCGATAAACAAATATCTTTTTTTTTTTGAGACAATCAAAAAAATATATATATTT
TTGTTTGTTTGCTTTTTTAGATTATTTTTAGATTTGCATTTGTACGTATTTTTAATATAC
ATTAAAAAATAAATTCTCTGGGAAAAGATATATAAAGTAAATTTAATAAATTATTATCAA
AAACTAAAAAACAAAAAGCAAAAAACAAACCAATTCTCTAAAATGACTTTCTCTGCTACC
GACCTCCCCACCCTCGAAAAGCACTTAGCTGCCCACACCTACCTTTCCGGTACTGATAAG
CCCGCTAAGATTGATGCTTAAATTGCCACCGAACTCAAGGGTAACTTATTTATTTACTAA
TCATTATCTCCCTCACATCCATCCATCCATTCACTTACTTACTCATTCACTCATTATTCG
GTGATCTCTTCCACTTAGACTTTTTTCTCTTAGAAAATTTTAAAATAATGGATTGAAGAA
AATAAACTTCTTTGAAATTTTTTAGTCAATATTGCTCTCTTAAAACACACTCAAGTTTTC
ATTAATAATTTATTAATATTATTTTAAATATATAGATAAGAAGGTTGCCCTCAACGCCGC
CACCCACCCCAACGTCTATGCCTGGTTCAGCTTCATCGGTTTATTCACCCCCGAAGCTCA
AAATACCTGGGCTGATGTTGCTCCCGTCGCCGTCCCCGTTGCTGCCAAGAAGGAAGCCAA
GAAGGAAACCAAGACCGTAAGAAATTTTTCTTTTATCAAGCAATAACAACAATGGAAATC
ATTTTAATTCTACCCATAACTCCTATAGCTTATTTACTTACTAACTTACAAAAGATAAAA
TGAATAAAAATAAATTTTCTTGATATATAAATAAATACCTATTCCCCCTTTGATATATAT
ATCGGAAAACATGCAAGCGACAAGCAAAGATAGGATTTTCATTGACCATAGAACCATTTT
TCTAAATTATTGTTGTATATAAATAGGACGATGTCGATCTTTTCGGTGATGATGATGAAG
AAGATGCTGAAGCTGAAGCTTTGAGAGAAAAGAAGAGACTCGAAGCCGTCGCTGCCAAGG
AAGCTAGAGATGGTAAGAAGAAGAAGGCTATTGCCAAGACTATCCTCGTCTTCAACGTCA
AGGTCTTCGAAGCTGAATAAGACTTAGACGCTTTGGCCAAGAAGATCTACGAAACCATCC
AACTCGACGGTTTGGTCTGGAACAAGGAACACAAGAAGATCCCCGTTGCCTTCGGTGTCT
TCATGCTCCAAATGGGTTGCATCATTGAAGACGATAAGGTCAACACCGACAGTATCTTCG
AACCCATCCAATCTTGGGAAGATGAAGTCCAATCCGTTGATGTTGAAACCATGCAAAAAC
TTTGA


>TTHERM_00859260(protein)
MNKEIVYLQYEMDWLLGCLFNRLIETQKTINFFLSQFLLFFHSINKYLFFFETIKKIYIF
LFVCFFRLFLDLHLYVFLIYIKKQILWEKIYKVNLINYYQKLKNKKQKTNQFSKMTFSAT
DLPTLEKHLAAHTYLSGTDKPAKIDAQIATELKDKKVALNAATHPNVYAWFSFIGLFTPE
AQNTWADVAPVAVPVAAKKEAKKETKTDDVDLFGDDDEEDAEAEALREKKRLEAVAAKEA
RDGKKKKAIAKTILVFNVKVFEAEQDLDALAKKIYETIQLDGLVWNKEHKKIPVAFGVFM
LQMGCIIEDDKVNTDSIFEPIQSWEDEVQSVDVETMQKL