Identifiers and Description

Gene Model Identifier

TTHERM_00865250

Standard Name

PPI8 (peptidylprolyl isomerase 8)

Aliases

PreTt29155 | 154.m00113 | 3751.m00459

Description

PPI8 peptidyl-prolyl cis-trans isomerase; PPIC-type PPIASE domain containing protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_19692.1 6.001756404910437e-77
Description: ppic-type ppiase domain-containing protein (119 aa)
Oxytricha Contig20619.0.g26 9.99648502569394e-38
Description: PPIC-type PPIASE domain
WormBase WBGene00022448 9.997975313387782e-28
Description: locus:pinn-1 status:Confirmed UniProt:Q9N492 protein_id:CCD72986.1
DictyBase DDB_G0268618 6.999211576891585e-27
Description: pinA on chromosome: 1 position 1957162 to 1958072
SGD YJR017C 1.0000422327488734e-24
Description: ESS1 Peptidylprolyl-cis/trans-isomerase (PPIase) specific for phosphorylated serine and threonine residues N-terminal to proline; regulates phosphorylation of the RNA polymerase II large subunit (Rpo21p) C-terminal domain
Stentor Coeruleus SteCoe_3768 0.000000000000004658886145103398
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00865250(coding)
ATGAAATCAGCTGATCCTTAAAAAACTTTTATGGAAATTGCACAAAAGTATTCTGAATGC
ACATCTGCTAGAAATGGAGGTGACTTGGGAGAGTTTGGTCCTGGTTAAATGCAAGAATCA
TTTGAATAGGCTGCATATGCTCTTAAAGTCGGAGAGATTTCTAACTTAGTTGAGTCAGAC
TCTGGTGTTCACATTATTTTAAGATTAGATTGA


>TTHERM_00865250(gene)
ATGAAATCAGCTGATCCTTAAAAAACTTTTATGGAAATTGCACAAAAGTATTCTGAATGC
ACATCTGCTAGAAATGGAGGTGACTTGGGAGAGTTTGGTCCTGGTTAAATGCAAGAATCA
TTTGAATAGGCTGCATATGCTCTTAAAGTCGGAGAGATTTCTAACTTAGTTGAGTCAGAC
TCTGGTGTTCACATTATTTTAAGATTAGATTGA


>TTHERM_00865250(protein)
MKSADPQKTFMEIAQKYSECTSARNGGDLGEFGPGQMQESFEQAAYALKVGEISNLVESD
SGVHIILRLD