Identifiers and Description

Gene Model Identifier

TTHERM_00865290

Standard Name

PPO1 (protein phosphatase 1 (PP1) ortholog)

Aliases

PreTt29159 | 154.m00117 | 3751.m00463

Description

PPO1 serine/threonine-protein phosphatase PP1; Glc7-like protein phosphatase; !!! Note that TTHERM_00865290 and TTHERM_00865300 are parts of a single gene !!!; Serine/threonine-protein phosphatase PP1 catalytic subunit

Genome Browser (Macronucleus)

Full Screen View

No Genome Browser Data Present

Genome Browser (Micronucleus)

Full Screen View

No Genome Browser Data Present

External Links

• Uniprot
• Alphafold

Gene Ontology Annotations

Cellular Component

• acyl-CoA ceramide synthase complex (IEA) | GO:0061576
• cell outer membrane (IEA) | GO:0009279
• cell surface (IEA) | GO:0009986
• cellulosome (IEA) | GO:0043263
• chloroplast ribosome (IEA) | GO:0043253
• ciliary neurotrophic factor receptor complex (IEA) | GO:0070110
• clathrin-sculpted gamma-aminobutyric acid transport vesicle membrane (IEA) | GO:0061202
• collagen type XIX trimer (IEA) | GO:1990318
• Dbf4-dependent protein kinase complex (IEA) | GO:0031431
• EGFR-Grb2-Sos complex (IEA) | GO:0070620
• endobrevin-SNAP-25-syntaxin-1a complex (IEA) | GO:0070048
• extracellular membraneless organelle (IEA) | GO:0043264
• Gram-negative-bacterium-type cell wall (IEA) | GO:0009276
• half bridge of spindle pole body (IEA) | GO:0005825
• inner plaque of mitotic spindle pole body (IEA) | GO:0061497
• insulin-responsive compartment (IEA) | GO:0032593
• ionotropic glutamate receptor complex (IEA) | GO:0008328
• low-density lipoprotein receptor complex (IEA) | GO:0062136
• MICOS complex (IEA) | GO:0061617
• mitochondrial ATP-gated potassium channel complex (IEA) | GO:0062157
• obsolete chromosome segregation-directing complex (IEA) | GO:0043913
• obsolete ectoplasm (IEA) | GO:0043265
• obsolete integral component of mitochondrial membrane (IEA) | GO:0032592
• obsolete transforming growth factor beta type I receptor homodimeric complex (IEA) | GO:0070018
• obsolete transforming growth factor beta1-type II receptor complex (IEA) | GO:0070020
• organellar chromatophore (IEA) | GO:0070111
• organellar chromatophore membrane (IEA) | GO:0070112
• outer plaque of spindle pole body (IEA) | GO:0005824
• phosphoinositide 3-kinase complex, class IA (IEA) | GO:0035030
• pilus (IEA) | GO:0009289
• primary cilium (IEA) | GO:0072372
• subrhabdomeral cisterna (IEA) | GO:0016029

Molecular Function

• (1->3),(1->4)-beta-glucan binding (IEA) | GO:2001077
• 11-deoxycorticosterone binding (IEA) | GO:1903878
• 17alpha-hydroxyprogesterone binding (IEA) | GO:1903880
• 2-keto-3-deoxy-L-rhamnonate aldolase activity (IEA) | GO:0106099
• 2-octaprenyl-6-methoxyphenol hydroxylase activity (IEA) | GO:0008681
• 2-oxoglutarate decarboxylase activity (IEA) | GO:0008683
• 2-oxopent-4-enoate hydratase activity (IEA) | GO:0008684
• 3-beta-hydroxy-delta5-steroid dehydrogenase (NAD+) activity (IEA) | GO:0003854
• 3-hydroxybutyrate dehydrogenase activity (IEA) | GO:0003858
• 3-hydroxybutyryl-CoA dehydrogenase activity (IEA) | GO:0008691
• 3-hydroxyisobutyryl-CoA hydrolase activity (IEA) | GO:0003860
• 8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase activity (IEA) | GO:0008413
• ABC-type amino acid transporter activity (IEA) | GO:0015424
• ABC-type ferric iron transporter activity (IEA) | GO:0015408
• ABC-type maltose transporter activity (IEA) | GO:0015423
• ABC-type oligosaccharide transporter activity (IEA) | GO:0015422
• acylglycerone-phosphate reductase (NADP+) activity (IEA) | GO:0000140
• ADP phosphatase activity (IEA) | GO:0043262
• aliphatic amine oxidase activity (IEA) | GO:0052595
• all-trans retinol 3,4-desaturase activity (IEA) | GO:0061896
• alpha-D-glucan binding (IEA) | GO:2001083
• aminotriazole transporter activity (IEA) | GO:0015241
• aromatase activity (IEA) | GO:0008402
• aromatic (S)-hydroxynitrile lyase activity (IEA) | GO:0052892
• arsenate reductase (glutaredoxin) activity (IEA) | GO:0008794
• axon guidance receptor activity (IEA) | GO:0008046
• C-5 sterol desaturase activity (IEA) | GO:0000248
• carbamate kinase activity (IEA) | GO:0008804
• carboxymethylenebutenolidase activity (IEA) | GO:0008806
• carboxyvinyl-carboxyphosphonate phosphorylmutase activity (IEA) | GO:0008807
• carotene beta-ring hydroxylase activity (IEA) | GO:0010291
• catechol O-methyltransferase activity (IEA) | GO:0016206
• CDP-diacylglycerol diphosphatase activity (IEA) | GO:0008715
• Cys-tRNA(Pro) hydrolase activity (IEA) | GO:0043907
• delta-type opioid receptor binding (IEA) | GO:0031850
• delta5-delta2,4-dienoyl-CoA isomerase activity (IEA) | GO:0008416
• deUFMylase activity (IEA) | GO:0071567
• dihydroneopterin triphosphate 2'-epimerase activity (IEA) | GO:0008719
• dolichyl pyrophosphate Glc2Man9GlcNAc2 alpha-1,2-glucosyltransferase activity (IEA) | GO:0106073
• ferredoxin-NAD(P) reductase activity (IEA) | GO:0008937
• ferric enterobactin:proton symporter activity (IEA) | GO:0015345
• ferric triacetylfusarinine C:proton symporter activity (IEA) | GO:0015346
• ferrous iron transmembrane transporter activity (IEA) | GO:0015093
• G protein-coupled neurotensin receptor activity (IEA) | GO:0016492
• G protein-coupled serotonin receptor binding (IEA) | GO:0031821
• high-affinity ferric iron transmembrane transporter activity (IEA) | GO:0015092
• histone deacetylase regulator activity (IEA) | GO:0035033
• histone H4K16 propionyltransferase activity (IEA) | GO:0141002
• K63-linked deubiquitinase activity (IEA) | GO:0061578
• L-allo-threonine aldolase activity (IEA) | GO:0008732
• L-carnitine CoA-transferase activity (IEA) | GO:0008735
• L-gamma-glutamyl-L-propargylglycine hydroxylase activity (IEA) | GO:0062148
• L(+)-tartrate dehydratase activity (IEA) | GO:0008730
• lactaldehyde reductase activity (IEA) | GO:0008912
• lanosterol synthase activity (IEA) | GO:0000250
• lipopolysaccharide heptosyltransferase activity (IEA) | GO:0008920
• lipopolysaccharide-1,6-galactosyltransferase activity (IEA) | GO:0008921
• long-chain-3-hydroxyacyl-CoA dehydrogenase activity (IEA) | GO:0016509
• lysine:proton symporter activity (IEA) | GO:0015493
• mannitol-1-phosphate 5-dehydrogenase activity (IEA) | GO:0008926
• mercury (II) reductase (NADP+) activity (IEA) | GO:0016152
• mercury ion transmembrane transporter activity (IEA) | GO:0015097
• methane monooxygenase [NAD(P)H] activity (IEA) | GO:0015049
• microtubule severing ATPase activity (IEA) | GO:0008568
• mitochondrial single subunit type RNA polymerase activity (IEA) | GO:0001065
• myoinhibitory hormone activity (IEA) | GO:0016085
• NAD+ synthase activity (IEA) | GO:0008795
• nicotinate N-methyltransferase activity (IEA) | GO:0008938
• O antigen ligase activity (IEA) | GO:0008754
• obsolete 4-chloronitrobenzene nitroreductase activity (IEA) | GO:0052602
• obsolete alpha-carotene epsilon hydroxylase activity (IEA) | GO:0072373
• obsolete aminoacetone:oxygen oxidoreductase(deaminating) activity (IEA) | GO:0052594
• obsolete apoptosis activator activity (IEA) | GO:0016506
• obsolete aspartic-type signal peptidase activity (IEA) | GO:0009049
• obsolete cation:cation antiporter activity (IEA) | GO:0015491
• obsolete cobalt, zinc uptake permease activity (IEA) | GO:0015339
• obsolete D-lysine oxidase activity (IEA) | GO:0043912
• obsolete delta-tocopherol cyclase activity (IEA) | GO:0052604
• obsolete diazepam binding inhibitor activity (IEA) | GO:0008025
• obsolete DNA topoisomerase IV activity (IEA) | GO:0008724
• obsolete oligopeptidase B activity (IEA) | GO:0008945
• obsolete peptidoglycan synthetase activity (IEA) | GO:0008954
• obsolete peptidyl-dipeptidase Dcp activity (IEA) | GO:0008956
• obsolete phosphatidylinositol 3-kinase, class I, catalyst activity (IEA) | GO:0015072
• obsolete proprotein convertase 2 activator activity (IEA) | GO:0016484
• obsolete protein tagging activity (IEA) | GO:0008638
• obsolete RNA polymerase I transcription regulator recruiting activity (IEA) | GO:0001186
• obsolete sodium-transporting two-sector ATPase activity (IEA) | GO:0015443
• obsolete sterol transporter activity (IEA) | GO:0015248
• obsolete tachykinin (IEA) | GO:0008648
• obsolete tubulin GTPase activity (IEA) | GO:0008550
• obsolete zinc, cadmium uptake permease activity (IEA) | GO:0015340
• obsolete zinc, iron permease activity (IEA) | GO:0015342
• oligonucleotidase activity (IEA) | GO:0008946
• oligoxyloglucan reducing-end-specific cellobiohydrolase activity (IEA) | GO:0033945
• oxidoreductase activity, acting on CH or CH2 groups, with an iron-sulfur protein as acceptor (IEA) | GO:0052592
• P-P-bond-hydrolysis-driven transmembrane transporter activity (IEA) | GO:0015405
• parathyroid hormone receptor binding (IEA) | GO:0031856
• peptidoglycan glycosyltransferase activity (IEA) | GO:0008955
• phosphate acetyltransferase activity (IEA) | GO:0008959
• phosphatidylserine decarboxylase activity (IEA) | GO:0004609
• phosphoglycolate phosphatase activity (IEA) | GO:0008967
• plastid PEP RNA polymerase core enzyme binding (IEA) | GO:0001052
• plastid sigma factor activity (IEA) | GO:0001053
• plastid single-subunit type RNA polymerase binding (IEA) | GO:0001051
• protein-transporting ATPase activity (IEA) | GO:0015450
• proteinase activated receptor binding (IEA) | GO:0031871
• putrescine:ornithine antiporter activity (IEA) | GO:0015496
• pyrophosphatase activity (IEA) | GO:0016462
• regulatory region RNA binding (IEA) | GO:0001069
• rhamnulose-1-phosphate aldolase activity (IEA) | GO:0008994
• RNA polymerase I activity (IEA) | GO:0001054
• RNA polymerase I general transcription initiation factor binding (IEA) | GO:0001179
• RNA polymerase II activity (IEA) | GO:0001055
• SAGA complex binding (IEA) | GO:0062070
• Ser(Gly)-tRNA(Ala) hydrolase activity (IEA) | GO:0043908
• siderophore-iron transmembrane transporter activity (IEA) | GO:0015343
• single-subunit type RNA polymerase binding (IEA) | GO:0001050
• sodium-independent organic anion transmembrane transporter activity (IEA) | GO:0015347
• sorbose reductase activity (IEA) | GO:0032115
• sphingomyelin phosphodiesterase activity (IEA) | GO:0004767
• sterol 14-demethylase activity (IEA) | GO:0008398
• sulfite oxidase activity (IEA) | GO:0008482
• telomerase RNA binding (IEA) | GO:0070034
• TFIID-class transcription factor complex binding (IEA) | GO:0001094
• thrombospondin receptor activity (IEA) | GO:0070053
• transcription regulatory region RNA binding (IEA) | GO:0001068
• type 2 proteinase activated receptor binding (IEA) | GO:0031873
• type 3 melanocortin receptor binding (IEA) | GO:0031781
• type 4 neuropeptide Y receptor binding (IEA) | GO:0031844
• UFM1 transferase activity (IEA) | GO:0071568
• undecaprenol kinase activity (IEA) | GO:0009038
• zinc efflux active transmembrane transporter activity (IEA) | GO:0015341

Biological Process

• (R)-mevalonic acid biosynthetic process (IEA) | GO:1901737
• 2'-deoxyribonucleotide biosynthetic process (IEA) | GO:0009265
• 3-keto-sphinganine metabolic process (IEA) | GO:0006666
• absorption of visible light (IEA) | GO:0016038
• adrenomedullin receptor signaling pathway (IEA) | GO:1990410
• allantoate transport (IEA) | GO:0015719
• anaerobic respiration (IEA) | GO:0009061
• arabinose transmembrane transport (IEA) | GO:0015751
• asparagine transport (IEA) | GO:0006867
• basement membrane organization (IEA) | GO:0071711
• bipolar cellular bud site selection (IEA) | GO:0007121
• branch elongation involved in ureteric bud branching (IEA) | GO:0060681
• bronchus development (IEA) | GO:0060433
• bud dilation involved in lung branching (IEA) | GO:0060503
• budding cell bud growth (IEA) | GO:0007117
• budding cell isotropic bud growth (IEA) | GO:0007119
• calcium ion export (IEA) | GO:1901660
• carotenoid metabolic process (IEA) | GO:0016116
• CD24 biosynthetic process (IEA) | GO:0035724
• CD4-positive, alpha-beta T cell activation (IEA) | GO:0035710
• cell migration in diencephalon (IEA) | GO:0061381
• cell surface receptor signaling pathway (IEA) | GO:0007166
• cell wall modification involved in fruit ripening (IEA) | GO:0009829
• cellular response to cocaine (IEA) | GO:0071314
• cellular response to D-galactose (IEA) | GO:1905378
• cellular response to diacyl bacterial lipopeptide (IEA) | GO:0071726
• cellular response to dopamine (IEA) | GO:1903351
• cellular response to dsRNA (IEA) | GO:0071359
• cellular response to fluoride (IEA) | GO:1902618
• cellular response to homocysteine (IEA) | GO:1905375
• cellular response to N-phenylthiourea (IEA) | GO:1902611
• cellular response to phosphate starvation (IEA) | GO:0016036
• cellular response to vanadate(3-) (IEA) | GO:1902439
• ceramide metabolic process (IEA) | GO:0006672
• ceramide phosphoethanolamine catabolic process (IEA) | GO:1905372
• ceramide phosphoethanolamine metabolic process (IEA) | GO:1905371
• cerebral cortex development (IEA) | GO:0021987
• chaperone-mediated protein folding (IEA) | GO:0061077
• chemokine (C-C motif) ligand 5 signaling pathway (IEA) | GO:0035689
• chloride transmembrane transport (IEA) | GO:1902476
• cichorine biosynthetic process (IEA) | GO:0062032
• coenzyme A biosynthetic process (IEA) | GO:0015937
• coenzyme A metabolic process (IEA) | GO:0015936
• commissural neuron axon guidance (IEA) | GO:0071679
• common myeloid progenitor cell proliferation (IEA) | GO:0035726
• cytoplasm organization (IEA) | GO:0007028
• cytosolic calcium ion transport (IEA) | GO:0060401
• deoxyribonucleotide biosynthetic process (IEA) | GO:0009263
• deoxyribonucleotide catabolic process (IEA) | GO:0009264
• detection of stimulus involved in Dma1-dependent checkpoint (IEA) | GO:1902419
• donor selection (IEA) | GO:0007535
• embryo implantation (IEA) | GO:0007566
• embryonic brain development (IEA) | GO:1990403
• endoplasmic reticulum to cytosol transport (IEA) | GO:1903513
• epithelial cell proliferation involved in lung bud dilation (IEA) | GO:0060505
• epithelium development (IEA) | GO:0060429
• establishment of tissue polarity (IEA) | GO:0007164
• exit from mitosis (EXP) | GO:0010458
• exosomal secretion (IEA) | GO:1990182
• extrinsic apoptotic signaling pathway via death domain receptors (IEA) | GO:0008625
• Factor XII activation (IEA) | GO:0002542
• fibroblast growth factor receptor signaling pathway (IEA) | GO:0008543
• galactose to glucose-1-phosphate metabolic process (IEA) | GO:0061612
• gamma-tubulin complex assembly (IEA) | GO:1902481
• glycolytic process from fructose through fructose-6-phosphate (IEA) | GO:0061616
• glycolytic process from glycerol (IEA) | GO:0061613
• glycolytic process through fructose-6-phosphate (IEA) | GO:0061615
• granzyme-mediated apoptotic signaling pathway (IEA) | GO:0008626
• heme A biosynthetic process (IEA) | GO:0006784
• heme biosynthetic process (IEA) | GO:0006783
• homogentisate metabolic process (IEA) | GO:1901999
• horizontal gene transfer (IEA) | GO:0009292
• immunoglobulin heavy chain V-D-J recombination (IEA) | GO:0071707
• inactivation of recombination (HML) (IEA) | GO:0007537
• induction by virus of host reticulophagy (IEA) | GO:0140883
• induction of apoptosis by extracellular signals (IEA) | GO:0008624
• inferior colliculus development (IEA) | GO:0061379
• interleukin-12-mediated signaling pathway (IEA) | GO:0035722
• interleukin-15-mediated signaling pathway (IEA) | GO:0035723
• internal genitalia morphogenesis (IEA) | GO:0035260
• intraciliary retrograde transport (IEA) | GO:0035721
• L-alanine catabolic process (IEA) | GO:0042853
• L-ornithine transmembrane transport (IEA) | GO:1903352
• L-phenylalanine biosynthetic process (IEA) | GO:0009094
• laminaritriose transport (IEA) | GO:2001097
• learning or memory (IEA) | GO:0007611
• left horn of sinus venosus development (IEA) | GO:0061079
• light absorption (IEA) | GO:0016037
• lung connective tissue development (IEA) | GO:0060427
• lung epithelium development (IEA) | GO:0060428
• lung saccule development (IEA) | GO:0060430
• macromolecule biosynthetic process (IEA) | GO:0009059
• maintenance of symbiont tolerance to host iron concentration (IEA) | GO:0075144
• maintenance of symbiont tolerance to host redox environment (IEA) | GO:0075143
• maltoheptaose catabolic process (IEA) | GO:2001123
• maltose catabolic process (IEA) | GO:0000025
• maltotetraose transport (IEA) | GO:2001099
• maturation of SSU-rRNA (IEA) | GO:0030490
• medium-term memory (IEA) | GO:0072375
• mesonephric glomerular mesangial cell fate commitment (IEA) | GO:0061264
• metanephric nephron tubule formation (IEA) | GO:0072289
• mitochondrial membrane organization (IEA) | GO:0007006
• mitotic anaphase (IEA) | GO:0000090
• mitotic anaphase A (IEA) | GO:0000091
• mitotic cell cycle checkpoint signaling (IEA) | GO:0007093
• mitotic cytokinetic cell separation (IEA) | GO:1902409
• mitotic DNA replication DNA ligation (IEA) | GO:1902973
• mitotic G2 DNA damage checkpoint signaling (IEA) | GO:0007095
• mitotic metaphase (IEA) | GO:0000089
• mitotic nuclear division (IEA) | GO:0007067
• mitotic nuclear division (EXP) | GO:0007067
• mitotic S phase (IEA) | GO:0000084
• mitotic spindle assembly checkpoint signaling (IEA) | GO:0007094
• modified histidine metabolic process (IEA) | GO:0052701
• modulation by host of symbiont molecular function (IEA) | GO:0052428
• modulation by organism of innate immune response in other organism involved in symbiotic interaction (IEA) | GO:0052306
• monoatomic cation homeostasis (IEA) | GO:0055080
• morphogenesis of an epithelial bud (IEA) | GO:0060572
• mRNA splicing, via endonucleolytic cleavage and ligation (IEA) | GO:0070054
• mucopolysaccharide metabolic process (IEA) | GO:1903510
• negative regulation by organism of cell-mediated immune response of other organism involved in symbiotic interaction (IEA) | GO:0052278
• negative regulation by organism of programmed cell death in other organism involved in symbiotic interaction (IEA) | GO:0052490
• negative regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process (IEA) | GO:1902647
• negative regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902642
• negative regulation of carotenoid biosynthetic process (IEA) | GO:1904142
• negative regulation of cell cycle G1/S phase transition (IEA) | GO:1902807
• negative regulation of cellular glucuronidation (IEA) | GO:2001030
• negative regulation of cellular response to hepatocyte growth factor stimulus (IEA) | GO:2001113
• negative regulation of chemokine (C-C motif) ligand 20 production (IEA) | GO:1903885
• negative regulation of chemokine-mediated signaling pathway (IEA) | GO:0070100
• negative regulation of chromosome organization (IEA) | GO:2001251
• negative regulation of complement-dependent cytotoxicity (IEA) | GO:1903660
• negative regulation of double-strand break repair via nonhomologous end joining (IEA) | GO:2001033
• negative regulation of eosinophil activation (IEA) | GO:1902567
• negative regulation of epidermal growth factor receptor signaling pathway involved in heart process (IEA) | GO:1905283
• negative regulation of epithelial cell-cell adhesion involved in epithelium migration (IEA) | GO:1903682
• negative regulation of immune effector process (IEA) | GO:0002698
• negative regulation of interleukin-10 secretion (IEA) | GO:2001180
• negative regulation of interleukin-27-mediated signaling pathway (IEA) | GO:0070108
• negative regulation of intrinsic apoptotic signaling pathway (IEA) | GO:2001243
• negative regulation of L-glutamine biosynthetic process (IEA) | GO:0062133
• negative regulation of late endosome to lysosome transport (IEA) | GO:1902823
• negative regulation of macrophage derived foam cell differentiation (IEA) | GO:0010745
• negative regulation of meiotic cell cycle phase transition (IEA) | GO:1901994
• negative regulation of metanephric nephron tubule epithelial cell differentiation (IEA) | GO:0072308
• negative regulation of microtubule depolymerization (IEA) | GO:0007026
• negative regulation of nephron tubule epithelial cell differentiation (IEA) | GO:0072183
• negative regulation of neural retina development (IEA) | GO:0061076
• negative regulation of PERK-mediated unfolded protein response (IEA) | GO:1903898
• negative regulation of phosphatidylserine exposure on apoptotic cell surface (IEA) | GO:1905781
• negative regulation of phospholipid translocation (IEA) | GO:0061093
• negative regulation of phytoalexin metabolic process (IEA) | GO:0052321
• negative regulation of postsynaptic membrane organization (IEA) | GO:1901627
• negative regulation of response to benzene (IEA) | GO:1901452
• negative regulation of response to drug (IEA) | GO:2001024
• negative regulation of retrograde transport, endosome to Golgi (IEA) | GO:1905280
• negative regulation of SCF-dependent proteasomal ubiquitin-dependent catabolic process (IEA) | GO:0062026
• negative regulation of sprouting angiogenesis (IEA) | GO:1903671
• negative regulation of vasculogenesis (IEA) | GO:2001213
• nephric duct development (IEA) | GO:0072176
• neutral lipid metabolic process (IEA) | GO:0006638
• Notch signaling pathway involved in negative regulation of venous endothelial cell fate commitment (IEA) | GO:2000796
• nucleocytoplasmic transport (IEA) | GO:0006913
• nucleoside monophosphate biosynthetic process (IEA) | GO:0009124
• nucleotide-binding oligomerization domain containing 2 signaling pathway (IEA) | GO:0070431
• nurse cell nucleus anchoring (IEA) | GO:0007302
• obsolete activation of MAPKKK activity (IEA) | GO:0000185
• obsolete aerotaxis on or near other organism involved in symbiotic interaction (IEA) | GO:0052238
• obsolete age dependent accumulation of genetic damage (IEA) | GO:0007570
• obsolete aging (IEA) | GO:0007568
• obsolete aluminum ion homeostasis (IEA) | GO:0055079
• obsolete autophagic death (sensu Saccharomyces) (IEA) | GO:0007577
• obsolete disruption of symbiont cellular component (IEA) | GO:0052183
• obsolete extracellular carbohydrate transport (IEA) | GO:0006859
• obsolete fertilization, exchange of chromosomal proteins (IEA) | GO:0035042
• obsolete hexose catabolic process to acetate (IEA) | GO:1902706
• obsolete histone H3-K56 deacetylation (IEA) | GO:0071572
• obsolete histone H3-S10 phosphorylation involved in chromosome condensation (EXP) | GO:2000775
• obsolete histone succinylation (IEA) | GO:0106077
• obsolete Immune memory response (IEA) | GO:1990982
• obsolete induction by organism of defense-related symbiont reactive oxygen species production (IEA) | GO:0052401
• obsolete killer activity (IEA) | GO:0007583
• obsolete loss of asymmetric budding (IEA) | GO:0007122
• obsolete MAPK cascade involved in ascospore formation (IEA) | GO:1903695
• obsolete metabolism by symbiont of host xylan (IEA) | GO:0052177
• obsolete modulation of transcription in other organism involved in symbiotic interaction (IEA) | GO:0052312
• obsolete mRNA endonucleolytic cleavage involved in unfolded protein response (IEA) | GO:0070055
• obsolete multi-organism cellular localization (IEA) | GO:1902581
• obsolete multi-organism intracellular transport (IEA) | GO:1902583
• obsolete negative regulation by organism of symbiont salicylic acid-mediated defense response (IEA) | GO:0052491
• obsolete negative regulation of adhesion of symbiont to host epithelial cell (IEA) | GO:1905227
• obsolete negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway (IEA) | GO:2001268
• obsolete negative regulation of histone H3-K27 methylation (IEA) | GO:0061086
• obsolete negative regulation of proteasome-activating ATPase activity (IEA) | GO:1902886
• obsolete phagosome formation (IEA) | GO:0006912
• obsolete positive chemotaxis in environment of other organism involved in symbiotic interaction (IEA) | GO:0052221
• obsolete positive regulation by host of symbiont defense response (IEA) | GO:0052197
• obsolete positive regulation by organism of defense-related symbiont reactive oxygen species production (IEA) | GO:0052349
• obsolete positive regulation by symbiont of host phytoalexin production (IEA) | GO:0052344
• obsolete positive regulation of adhesion of symbiont to host epithelial cell (IEA) | GO:1905228
• obsolete positive regulation of G2 phase of mitotic cell cycle (IEA) | GO:2001221
• obsolete positive regulation of nucleic acid-templated transcription (IEA) | GO:1903508
• obsolete positive regulation of response to DNA damage stimulus (IEA) | GO:2001022
• obsolete process resulting in tolerance to hydrolysate (IEA) | GO:1990368
• obsolete prothoracic morphogenesis (IEA) | GO:0007471
• obsolete regulation of 1-deoxy-D-xylulose-5-phosphate synthase activity (IEA) | GO:1902395
• obsolete regulation of cellular ketone metabolic process by regulation of transcription from RNA polymerase II promoter (IEA) | GO:0072364
• obsolete regulation of histone H3-K27 methylation (IEA) | GO:0061085
• obsolete regulation of histone H3-K79 methylation (IEA) | GO:2001160
• obsolete regulation of nucleic acid-templated transcription (IEA) | GO:1903506
• obsolete regulation of proteasome-activating ATPase activity (IEA) | GO:1902885
• obsolete reproduction (IEA) | GO:0000003
• obsolete response to inorganic substance (IEA) | GO:0010035
• obsolete response to long exposure to lithium ion (IEA) | GO:0043460
• obsolete RING-like zinc finger domain-mediated complex assembly (IEA) | GO:0071536
• obsolete senescence factor accumulation (IEA) | GO:0007579
• obsolete sodium/potassium transport (IEA) | GO:0006815
• obsolete transmembrane receptor protein tyrosine kinase ligand binding (IEA) | GO:0007170
• olfactory cortex development (IEA) | GO:0021989
• ommochrome biosynthetic process (IEA) | GO:0006727
• P granule assembly (IEA) | GO:1903863
• P granule disassembly (IEA) | GO:1903864
• peptidoglycan-based cell wall biogenesis (IEA) | GO:0009273
• peptidyl-lysine modification to peptidyl-hypusine (IEA) | GO:0008612
• peripheral tolerance induction (IEA) | GO:0002465
• peripheral tolerance induction to self antigen (IEA) | GO:0002466
• phage shock (IEA) | GO:0009271
• phagocytosis (IEA) | GO:0006909
• phagocytosis, engulfment (IEA) | GO:0006911
• phenanthrene catabolic process via trans-9(R),10(R)-dihydrodiolphenanthrene (IEA) | GO:0018956
• phenylpropanoid metabolic process (IEA) | GO:0009698
• phosphate-containing compound metabolic process (IEA) | GO:0006796
• photoreceptor cell morphogenesis (IEA) | GO:0008594
• photosynthetic NADP+ reduction (IEA) | GO:0009780
• phytochromobilin biosynthetic process (IEA) | GO:0010024
• placenta blood vessel development (IEA) | GO:0060674
• plant-type cell wall modification (IEA) | GO:0009827
• plant-type secondary cell wall biogenesis (IEA) | GO:0009834
• positive regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902643
• positive regulation of ammonia assimilation cycle (IEA) | GO:2001250
• positive regulation of antifungal innate immune response (IEA) | GO:1905036
• positive regulation of antigen processing and presentation of endogenous peptide antigen via MHC class I (IEA) | GO:1904284
• positive regulation of axon guidance (IEA) | GO:1902669
• positive regulation of border follicle cell migration (IEA) | GO:1903688
• positive regulation of deacetylase activity (IEA) | GO:0090045
• positive regulation of defense response to bacterium, incompatible interaction (IEA) | GO:1902479
• positive regulation of dendrite extension (IEA) | GO:1903861
• positive regulation of double-strand break repair via nonhomologous end joining (IEA) | GO:2001034
• positive regulation of epithelial cell proliferation involved in lung bud dilation (IEA) | GO:0060504
• positive regulation of fatty acid beta-oxidation using acyl-CoA dehydrogenase (IEA) | GO:1904737
• positive regulation of flavonoid biosynthetic process (IEA) | GO:0009963
• positive regulation of forebrain neuron differentiation (IEA) | GO:2000979
• positive regulation of glutamate neurotransmitter secretion in response to membrane depolarization (IEA) | GO:0061646
• positive regulation of I-kappaB phosphorylation (IEA) | GO:1903721
• positive regulation of interleukin-10 secretion (IEA) | GO:2001181
• positive regulation of interleukin-27-mediated signaling pathway (IEA) | GO:0070109
• positive regulation of macrophage derived foam cell differentiation (IEA) | GO:0010744
• positive regulation of ovulation (IEA) | GO:0060279
• positive regulation of oxidative phosphorylation (IEA) | GO:1903862
• positive regulation of peroxisome proliferator activated receptor signaling pathway (IEA) | GO:0035360
• positive regulation of phosphatidylserine exposure on apoptotic cell surface (IEA) | GO:1905782
• positive regulation of phospholipid translocation (IEA) | GO:0061092
• positive regulation of phytoalexin biosynthetic process (IEA) | GO:0052322
• positive regulation of plant epidermal cell differentiation (IEA) | GO:1903890
• positive regulation of prostaglandin secretion involved in immune response (IEA) | GO:0061078
• positive regulation of protein acetylation (IEA) | GO:1901985
• positive regulation of protein autoubiquitination (IEA) | GO:1902499
• positive regulation of response to water deprivation (IEA) | GO:1902584
• positive regulation of retrograde transport, endosome to Golgi (IEA) | GO:1905281
• positive regulation of SCF-dependent proteasomal ubiquitin-dependent catabolic process (IEA) | GO:0062027
• positive regulation of small molecule metabolic process (IEA) | GO:0062013
• positive regulation of somitomeric trunk muscle development (IEA) | GO:0014709
• positive regulation of sterol transport (IEA) | GO:0032373
• positive regulation of tumor necrosis factor biosynthetic process (IEA) | GO:0042535
• positive regulation of wound healing, spreading of epidermal cells (IEA) | GO:1903691
• premeiotic DNA replication DNA duplex unwinding (IEA) | GO:1902970
• primary lung bud formation (IEA) | GO:0060431
• priming of cellular response to stress (IEA) | GO:0080136
• programmed cell death (IEA) | GO:0012501
• pronephric glomerulus morphogenesis (IEA) | GO:0035775
• pronephric proximal tubule development (IEA) | GO:0035776
• pronuclear fusion (IEA) | GO:0007344
• propan-2-ol biosynthetic process (IEA) | GO:1902640
• prostate induction (IEA) | GO:0060514
• protein activation cascade (IEA) | GO:0072376
• protein localization to condensed chromosome (IEA) | GO:1903083
• protein localization to old growing cell tip (IEA) | GO:1903858
• protein processing (IEA) | GO:0016485
• protein transport into membrane raft (IEA) | GO:0032596
• prothoracic disc morphogenesis (IEA) | GO:0007470
• purine nucleoside monophosphate catabolic process (IEA) | GO:0009128
• purine ribonucleoside triphosphate metabolic process (IEA) | GO:0009205
• purine ribonucleotide metabolic process (IEA) | GO:0009150
• pyrimidine deoxyribonucleoside triphosphate catabolic process (IEA) | GO:0009213
• pyrimidine nucleobase fermentation (IEA) | GO:0043466
• pyrimidine nucleotide salvage (IEA) | GO:0032262
• quercetin catabolic process (IEA) | GO:1901733
• quercetin metabolic process (IEA) | GO:1901732
• receptor guanylyl cyclase signaling pathway (IEA) | GO:0007168
• regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process (IEA) | GO:1902646
• regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902641
• regulation of anterograde synaptic vesicle transport (IEA) | GO:1903742
• regulation of antisense RNA transcription (IEA) | GO:0060194
• regulation of border follicle cell migration (IEA) | GO:1903684
• regulation of capsule polysaccharide biosynthetic process (IEA) | GO:0062084
• regulation of cellular glucuronidation (IEA) | GO:2001029
• regulation of cellular respiration (IEA) | GO:0043457
• regulation of chitin-based cuticle tanning (IEA) | GO:0007564
• regulation of cholesterol transport (IEA) | GO:0032374
• regulation of complement-dependent cytotoxicity (IEA) | GO:1903659
• regulation of cytokinin dehydrogenase activity (IEA) | GO:1903856
• regulation of defense response to bacterium, incompatible interaction (IEA) | GO:1902477
• regulation of ecdysteroid secretion (IEA) | GO:0007555
• regulation of epidermal growth factor receptor signaling pathway involved in heart process (IEA) | GO:1905282
• regulation of exocyst assembly (IEA) | GO:0001928
• regulation of gastric motility (IEA) | GO:1905333
• regulation of germ cell proliferation (IEA) | GO:1905936
• regulation of hematopoietic progenitor cell differentiation (IEA) | GO:1901532
• regulation of hemicellulose catabolic process (IEA) | GO:2000988
• regulation of inner ear receptor cell differentiation (IEA) | GO:2000980
• regulation of interferon-beta secretion (IEA) | GO:0035547
• regulation of interleukin-27-mediated signaling pathway (IEA) | GO:0070107
• regulation of intracellular sterol transport (IEA) | GO:0032380
• regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator (IEA) | GO:1902165
• regulation of L-arginine import into cell (IEA) | GO:1902826
• regulation of late endosome to lysosome transport (IEA) | GO:1902822
• regulation of male mating behavior (IEA) | GO:1902435
• regulation of membrane lipid metabolic process (IEA) | GO:1905038
• regulation of microglial cell migration (IEA) | GO:1904139
• regulation of mitotic cell cycle DNA replication (IEA) | GO:1903463
• regulation of natural killer cell differentiation (IEA) | GO:0032823
• regulation of nucleus organization (IEA) | GO:1903353
• regulation of pentose-phosphate shunt (IEA) | GO:0043456
• regulation of PERK-mediated unfolded protein response (IEA) | GO:1903897
• regulation of phosphatidylcholine biosynthetic process (IEA) | GO:2001245
• regulation of phosphorus utilization (IEA) | GO:0006795
• regulation of plant epidermal cell differentiation (IEA) | GO:1903888
• regulation of production of siRNA involved in RNA interference (IEA) | GO:0090065
• regulation of protein maturation by peptide bond cleavage (IEA) | GO:0010953
• regulation of response to oxidative stress (IEA) | GO:1902882
• regulation of rhamnose catabolic process (IEA) | GO:0043463
• regulation of RNA binding transcription factor activity (IEA) | GO:1905255
• regulation of satellite cell activation involved in skeletal muscle regeneration (IEA) | GO:0014717
• regulation of SCF-dependent proteasomal ubiquitin-dependent protein catabolic process (IEA) | GO:0062025
• regulation of signal transduction (IEA) | GO:0009966
• regulation of signal transduction involved in conjugation with cellular fusion (IEA) | GO:0060238
• regulation of small molecule metabolic process (IEA) | GO:0062012
• regulation of stress granule assembly (IEA) | GO:0062028
• regulation of thyroid gland epithelial cell proliferation (IEA) | GO:1904441
• regulation of transcriptional start site selection at RNA polymerase II promoter (IEA) | GO:0001178
• regulatory T cell apoptotic process (IEA) | GO:1902482
• release of sequestered calcium ion into cytosol by endoplasmic reticulum (IEA) | GO:1903514
• response to curcumin (IEA) | GO:1904643
• response to D-galactose (IEA) | GO:1905377
• response to ethylene (IEA) | GO:0009723
• response to iron(II) ion (IEA) | GO:0010040
• response to methamphetamine hydrochloride (IEA) | GO:1904313
• response to reactive oxygen species (IEA) | GO:0000302
• response to singlet oxygen (IEA) | GO:0000304
• Rho protein signal transduction (IEA) | GO:0007266
• secondary shoot formation (IEA) | GO:0010223
• sensory organ boundary specification (IEA) | GO:0008052
• sesquiterpenoid biosynthetic process (IEA) | GO:0016106
• signal transduction (IEA) | GO:0007165
• sodium ion transmembrane transport (IEA) | GO:0035725
• sodium-independent prostaglandin transport (IEA) | GO:0071720
• somatic recombination of immunoglobulin gene segments (IEA) | GO:0016447
• sperm aster formation (IEA) | GO:0035044
• sperm DNA decondensation (IEA) | GO:0035041
• spermatogonial cell division (IEA) | GO:0007284
• sterol metabolic process (IEA) | GO:0016125
• sterol regulatory element binding protein cleavage involved in ER-nuclear sterol response pathway (IEA) | GO:0006992
• sterol regulatory element binding protein import into nucleus involved in sterol depletion response (IEA) | GO:0006993
• stomach neuroendocrine cell differentiation (IEA) | GO:0061102
• superior colliculus development (IEA) | GO:0061380
• synaptic vesicle docking (IEA) | GO:0016081
• synaptic vesicle priming (IEA) | GO:0016082
• T-helper 1 cell lineage commitment (IEA) | GO:0002296
• telium development (IEA) | GO:0075275
• terpenoid catabolic process (IEA) | GO:0016115
• tertiary alcohol biosynthetic process (IEA) | GO:1902645
• tetrasaccharide transport (IEA) | GO:2001098
• transcription by RNA polymerase V (IEA) | GO:0001060
• transcription initiation from RNA polymerase I promoter for nuclear large rRNA transcript (IEA) | GO:0001180
• triterpenoid catabolic process (IEA) | GO:0016105
• tRNA import into mitochondrion (IEA) | GO:0016031
• ureter development (IEA) | GO:0072189
• vacuolar acidification (IEA) | GO:0007035
• vesicle coating (IEA) | GO:0006901
• visual behavior (IEA) | GO:0007632
• vitelline membrane formation involved in chorion-containing eggshell formation (IEA) | GO:0007305
• wing disc morphogenesis (IEA) | GO:0007472
• xanthophyll biosynthetic process (IEA) | GO:0016123
• xanthophyll catabolic process (IEA) | GO:0016124
• zygosporangium development (IEA) | GO:0075271

Domains

• ( PF00149 ) Calcineurin-like phosphoesterase
• ( PF16891 ) Serine-threonine protein phosphatase N-terminal domain

Gene Expression Profile

Vegetative Cell Cycle (Zhang et al., 2023)

GeneMania

No results were calculated for this gene in GeneMania.

Tetrahymena Stock Center

• ( SD01771 ) Macronucleus: PPO1 gene with 2 HA tags at n-terminus partially replace MTT1 coding, also neo2 in 5’ flanking region of MTT1.
• ( SD02196 ) Macronucleus: HA tagged HTAY and PPO1 with n-terminal V5 tag
• ( SD02197 ) Macronucleus: HA tagged HTAY and PPO1 with n-terminal V5 tag
• ( SD02539 ) Macronucleus: Ppo1p with n-terminal V5 tag, cells very sick, not used in paper
• ( SD02540 ) Macronucleus: Ppo1p with n-terminal V5 tag
• ( SD02732 ) Macronucleus: HA tagged HTAY and PPO1 with n-terminal V5 tag.
• ( SD02733 ) Macronucleus: HA tagged HTAY and PPO1 with n-terminal V5 tag
• ( SD02818 ) Macronucleus: PPO1 gene with 2 HA tags at n-terminus partially replace MTT1 coding, also neo2 in 5’ flanking region of MTT1.
• ( SD02819 ) Macronucleus: PPO1 gene with 2 HA tags at n-terminus partially replace MTT1 coding, also neo2 in 5’ flanking region of MTT1.
• ( SD02820 ) Macronucleus: PPO1 gene with 2 HA tags at n-terminus partially replace MTT1 coding, also neo2 in 5’ flanking region of MTT1.
• ( SD02821 ) Macronucleus: PPO1 gene with 2 HA tags at n-terminus partially replace MTT1 coding, also neo2 in 5’ flanking region of MTT1.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

1. Ref:22426537: Song X, Bowen J, Miao W, Liu Y, Gorovsky MA (2012) The nonhistone, N-terminal tail of an essential, chimeric H2A variant regulates mitotic H3-S10 dephosphorylation. Genes & development 26(6):615-29
2. Ref:10199406: Wei Y, Yu L, Bowen J, Gorovsky MA, Allis CD (1999) Phosphorylation of histone H3 is required for proper chromosome condensation and segregation. Cell 97(1):99-109
3. Ref:9636175: Wei Y, Mizzen CA, Cook RG, Gorovsky MA, Allis CD (1998) Phosphorylation of histone H3 at serine 10 is correlated with chromosome condensation during mitosis and meiosis in Tetrahymena. Proceedings of the National Academy of Sciences of the United States of America 95(13):7480-4

Sequences

>TTHERM_00865290(coding)
ATGGACGGAAAAACAGTCATTGATATTGATGATATCCTATCAAAATTGATAGATCCAAAG
CAAAGTAGAGCAGCTAAAAGTTAGGTTTTGGCTGAAAGCGAAATTAGGGCTGTTTGCATG
AAGTCAAGAGAAATCTTTTTGCAATAGCCAATGCTTTTAGAGTTAGAAGCTCCCATTAAA
ATTTGTGGTGATGTTCATGGCCAATTCCCTGATTTACTTAGAATTTTCGAATACGGAGGA
TTCCCTCCTGATGCCAATTATCTCTTTTTAGGAGATTACGTTGATAGAGGCAAATAATCA
CTAGAAACAATTTGTTTGCTCTTAGCTTATAAAATCAAATTTCCTGAGAATTTCTTCTTG
CTTCGTGGTAACCACGAATGCTCCTCCATTAATCGTATATATGGTTTCTATGATGAATGT
AAAAGAAGATATAATATAAAGCTCTGGAAAATTTTTACTGACTGCTTTAATTGCCTTCCA
GTCTGTGCAGTGATAGATGAAAAAATTATTTGTATGCACGGAGGTCTTTCACCTTCTCCT
GAATTTAATAATATAGAATCTATTCATCGTATAACACGTCCAATTGAAGTTCCTGACTAA
GGTTTATTATGCGATCTATTGTGGAGTGACCCTGAAAAAGATATTCTTGGTTGGGGTGAT
AATGAAAGAGGTGTTAGTTATATATTTGGACCAGATGAGGTCTCGAAATTCCTAAAGAAA
TAAGATTTAGATTTAATATGTAGAGCACATTAGGTAGTCGAAGATGGATATGAGTTCTTC
GCAAAAAGATAGTTAGTCACAATCTTTTCAGCTCCTAATTATTGTGGTGAATTTGATAAT
TGCGGTGCTTTAATGTCTGTAGATGAGACTTTAATGTGTAGCTTCTAAATATTAAAACCT
GCAGATAAAAAATCTTAAACTTAACGTCCTAAAACTCCAAAGTTTGTCAATTGA

>TTHERM_00865290(gene)
TAGAAGTTAATAAGAAGAAACATGAATTATTACTAAGTAGTTTAAAACAGCAAGAATAGT
AAACTATAGCTAACAAATTAACAAATAAATCATCAAATAATCAATCTAAAGAAGCAGAAA
AAGCAAAAAAATAAAAAAAATAAAGAAAAAATAAAAGGAAACTGAAGAAGATTAAACAAA
TCATTAAATAGCGATAATGGACGGAAAAACAGTCATTGATATTGATGATATCCTATCAAA
ATTGATAGATCCAAAGCAAAGTAGAGCAGCTAAAAGTTAGGTTTTGGCTGAAAGCGAAAT
TAGGGCTGTTTGCATGAAGTCAAGAGAAATCTTTTTGCAATAGCCAATGCTTTTAGAGTT
AGAAGCTCCCATTAAAATTTGTGGTGATGTTCATGGCCAATTCCCTGATTTACTTAGAAT
TTTCGAATACGGAGGATTCCCTCCTGATGCCAATTATCTCTTTTTAGGAGATTACGTTGA
TAGAGGCAAATAATCACTAGAAACAATTTGTTTGCTCTTAGCTTATAAAATCAAATTTCC
TGAGAATTTCTTCTTGCTTCGTGGTAACCACGAATGCTCCTCCATTAATCGTATATATGG
TTTCTATGATGAATGTAAAAGAAGATATAATATAAAGCTCTGGAAAATTTTTACTGACTG
CTTTAATTGCCTTCCAGTCTGTGCAGTGATAGATGAAAAAATTATTTGTATGCACGGAGG
TCTTTCACCTTCTCCTGAATTTAATAATATAGAATCTATTCATCGTATAACACGTCCAAT
TGAAGTTCCTGACTAAGGTTTATTATGCGATCTATTGTGGAGTGACCCTGAAAAAGATAT
TCTTGGTTGGGGTGATAATGAAAGAGGTGTTAGTTATATATTTGGACCAGATGAGGTCTC
GAAATTCCTAAAGAAATAAGATTTAGATTTAATATGTAGAGCACATTAGGTAGTCGAAGA
TGGATATGAGTTCTTCGCAAAAAGATAGTTAGTCACAATCTTTTCAGCTCCTAATTATTG
TGGTGAATTTGATAATTGCGGTGCTTTAATGTCTGTAGATGAGACTTTAATGTGTAGCTT
CTAAATATTAAAACCTGCAGATAAAAAATCTTAAACTTAACGTCCTAAAACTCCAAAGTT
TGTCAATTGAAAGATAAATTAGTTAGTAATCAAATAAATTATAAATTAACATTTTTGTTT
ATCATTTACTTATGGATGGATGCTCAGAGATTGGTTATAATGGTAAAAGTAAAAAAAATA
TCAAATCCATGATGGCCTTTTAATCTTAAATCCCTTAACAAATATATTAATAAGTACTCA
ATAAATAGCTAGCTAACTTTGTAATTTTAAATAGAAAAAGCAAACAAATTATAAATAACC
AAACATAAATAACATTTAATTTTATGTTCAATAAAACAAAATTAACTTATAAATATTTTT
ATGTATTTAATAATTATAGTTAATTAAGAGAATATTTTTTAATCTTCTCCAATATAGTAA
AAAATTATCTATAACATTATAAGTATCCATGTTATCTGCATTTTTAAAACTAAGCTGAAT
TTTAATTATCTTCCTTGAACTCAACCCTCGAGATTAATTACTTCAACATTCTTTATT

>TTHERM_00865290(protein)
MDGKTVIDIDDILSKLIDPKQSRAAKSQVLAESEIRAVCMKSREIFLQQPMLLELEAPIK
ICGDVHGQFPDLLRIFEYGGFPPDANYLFLGDYVDRGKQSLETICLLLAYKIKFPENFFL
LRGNHECSSINRIYGFYDECKRRYNIKLWKIFTDCFNCLPVCAVIDEKIICMHGGLSPSP
EFNNIESIHRITRPIEVPDQGLLCDLLWSDPEKDILGWGDNERGVSYIFGPDEVSKFLKK
QDLDLICRAHQVVEDGYEFFAKRQLVTIFSAPNYCGEFDNCGALMSVDETLMCSFQILKP
ADKKSQTQRPKTPKFVN