Identifiers and Description

Gene Model Identifier

TTHERM_00877050

Standard Name

PPI1 (peptidylprolyl isomerase 1)

Aliases

PreTt09701 | 156.m00085

Description

PPI1 peptidyl-prolyl cis-trans isomerase cyclophilin-type protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00160 ) peptidyl-prolyl cis-trans isomerase, cyclophilin-type

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_03176.1 3.998986577109865e-118
Description: peptidyl-prolyl cis-trans isomerase, cyclophilin-type family protein (250 aa)
DictyBase DDB_G0269120 9.998819815181669e-76
Description: cypB on chromosome: 1 position 3371521 to 3372496
WormBase WBGene00000877 2.9997879492220375e-71
Description: locus:cyn-1 Peptidyl-prolyl cis-trans isomerase 1 status:Confirmed UniProt:P52009 protein_id:CAA22075.1
Oxytricha Contig22608.0.g34 2.000597631390999e-64
Description: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
SGD YDR155C 3.000745802558524e-63
Description: CPR1 Cytoplasmic peptidyl-prolyl cis-trans isomerase (cyclophilin), catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; binds the drug cyclosporin A
Stentor Coeruleus SteCoe_24315 7.281290178321643e-33
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00877050(coding)
ATGAATAAGGGTTATTACTTATTAGTCGCTTTGGCAATTCTCGCAGTTGCTTCTGCCAAT
TTGAAGGAAGAAAAGATTACCAAGAAGGTCAGATTTACTGTTACATTCGATGGTAAGGAA
CCTGGTTTTGTTGAAATCGGTCTTTTCGGTTAAACTGTTCCCAAGACTGTTGAAAATTTC
CGTGCCCTCTGCACTGGTGAATTAGGTGAAAGTAATGGTCACAAGCTCTCTTACAAGGGA
TCTAAGTTCCACAGAATCATCCCTAACTTCATGGTTTAAGGAGGTGACTTCACCAACCAC
AATGGCACTGGTGGTCTTTCCATTTATGGTTCTAAATTCCAAGATGAAAACTTCAAGCTT
AGACACGAACCTTACTGCCTCTCTATGGCTAATGCTGGTCCTAACACCAACGGATCTCAA
TTCTTTATCACCACTGCTTAAACCAGTTGGTTAGATGGACGTCACGTTGTTTTCGGTAGA
GTTACTTAAGGTGAAGACATCGTCAGAAAGATCGAAGCTGCAGGTTCTCCTTCCGGTACT
CCTTCTAAGAACGTCGTTATTGCTGACTGTACTGAAGTTGATTTAGATTGA


>TTHERM_00877050(gene)
ATGAATAAGGGTTATTACTTATTAGTCGCTTTGGCAATTCTCGCAGTTGCTTCTGCCAAT
TTGAAGGAAGAAAAGATTACCAAGAAGGTCAGATTTACTGTTACATTCGATGGTAAGGAA
CCTGGTTTTGTTGAAATCGGTCTTTTCGGTTAAACTGTTCCCAAGACTGTTGAAAATTTC
CGTGCCCTCTGCACTGGTGAATTAGGTGAAAGTAATGGTCACAAGCTCTCTTACAAGGGA
TCTAAGTTCCACAGAATCATCCCTAACTTCATGGTTTAAGGAGGTGACTTCACCAACCAC
AATGGCACTGGTGGTCTTTCCATTTATGGTTCTAAATTCCAAGATGAAAACTTCAAGCTT
AGACACGAACCTTACTGCCTCTCTATGGCTAATGCTGGTCCTAACACCAACGGATCTCAA
TTCTTTATCACCACTGCTTAAACCAGTTGGTTAGATGGACGTCACGTTGTTTTCGGTAGA
GTTACTTAAGGTGAAGACATCGTCAGAAAGATCGAAGCTGCAGGTTCTCCTTCCGGTACT
CCTTCTAAGAACGTCGTTATTGCTGACTGTACTGAAGTTGATTTAGATTGA


>TTHERM_00877050(protein)
MNKGYYLLVALAILAVASANLKEEKITKKVRFTVTFDGKEPGFVEIGLFGQTVPKTVENF
RALCTGELGESNGHKLSYKGSKFHRIIPNFMVQGGDFTNHNGTGGLSIYGSKFQDENFKL
RHEPYCLSMANAGPNTNGSQFFITTAQTSWLDGRHVVFGRVTQGEDIVRKIEAAGSPSGT
PSKNVVIADCTEVDLD