Identifiers and Description

Gene Model Identifier

TTHERM_00878210

Standard Name

CTH112 (CaTHepsin 112)

Aliases

PreTt09718 | 156.m00102

Description

CTH112 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09211.1 9.000740126599256e-127
Description: papain family cysteine protease containing protein (324 aa)
Oxytricha Contig1254.0.g80 1.9997255150861791e-53
Description: Papain family cysteine protease
DictyBase DDB_G0272815 2.000704504372864e-47
Description: cprE on chromosome: 2 position 2212329 to 2213613
WormBase WBGene00000776 1.0003292389192957e-45
Description: locus:cpl-1 status:Confirmed UniProt:O45734 protein_id:CAB07275.1
Stentor Coeruleus SteCoe_27084 4.780892883885469e-25
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00878210(coding)
ATGAATAGATTTATCCTTTTGAGTATTATCATGCTCATGCCTATTTGTTTGACTTAAGAT
ATAAGTGTAGAAAAACTCCTTGCTTATAATAGATGGTCAAGCTAAAATCAAAGAGTGTAT
CTGAATGAAGATGAAAAACTATTTAGACAAATGGTTTTCTTTGAGAACTTGTAAAAGATT
AAGGAACATAATAGTAATCCTAACAATACCTATTCTATTGATGTTAACTAATTCTCAGAT
ATGACTTAAGAAGAATTTACTGAAAAAATTCTTATGAAATAGGATTTGGTTGACCATCAA
ATAAAAGATATTGGTTAATAGGCTACCAATAATAATGATAATAAGGAAATGAAAGCATCA
AATCTTGCTATCGCTGCTTCTATAGACTGGAGAACAAAAGGTGCTGTAACTACGGTTAAG
AATTAAGGTAGTTGTGGTTCATGCTGGAGTTTCTCTGCAGCTGGCTTAATGGAGTCATTT
AACTTCATTTCAAACAAAGCTTTAGTTGATTTTTCTGAGCAATAACTCGTTGATTGTGTC
ATCCCTGCAAACGGTTACTCCTCTTAAGGATGTAACGGAGGATGGCCTGTTTAATGTCTT
GATTATGCCTCCAAAGTAGGTATCACTACCCTATAGAGCTATCCATATGTTGCAATTTAA
AAGAAGTGTGCTGTGACTGGTACAAATAACGGGTTTAAGCCTAAAAAGTGGATTTAAATT
CCTAACACTTCGAACGATTTAAAAAGTGCTTTGAATTTCTCTCCTGTTTCTGTTCTTGTT
GATGCTTCTACTTGGGGCCAATATAAGTCTGGAATTTACAATGGATGTAACTAATCTAAT
ATTAGATTAAACCATGCTGTATTAGCTGTTGGCTATGACTAACAAGGTAATTGGATCGTT
AAAAATTCTTGGAGCACTAGTTGGGGTGAAAATGGCTATATTAGACTTGCTCCAAACAAC
ACATGCGGTATATTAAGCTATAATCTTTAAGTTACTGCATGA


>TTHERM_00878210(gene)
ATGAATAGATTTATCCTTTTGAGTATTATCATGCTCATGCCTATTTGTTTGACTTAAGAT
ATAAGTGTAGAAAAACTCCTTGCTTATAATAGATGGTCAAGCTAAAATCAAAGAGTGTAT
CTGAATGAAGATGAAAAACTATTTAGACAAATGGTTTTCTTTGAGAACTTGTAAAAGATT
AAGGAACATAATAGTAATCCTAACAATACCTATTCTATTGATGTTAACTAATTCTCAGAT
ATGACTTAAGAAGAATTTACTGAAAAAATTCTTATGAAATAGGATTTGGTTGACCATCAA
ATAAAAGATATTGGTTAATAGGCTACCAATAATAATGATAATAAGGAAATGAAAGCATCA
AATCTTGCTATCGCTGCTTCTATAGACTGGAGAACAAAAGGTGCTGTAACTACGGTTAAG
AATTAAGGTAGTTGTGGTTCATGCTGGAGTTTCTCTGCAGCTGGCTTAATGGAGTCATTT
AACTTCATTTCAAACAAAGCTTTAGTTGATTTTTCTGAGCAATAACTCGTTGATTGTGTC
ATCCCTGCAAACGGTTACTCCTCTTAAGGATGTAACGGAGGATGGCCTGTTTAATGTCTT
GATTATGCCTCCAAAGTAGGTATCACTACCCTATAGAGCTATCCATATGTTGCAATTTAA
AAGAAGTGTGCTGTGACTGGTACAAATAACGGGTTTAAGCCTAAAAAGTGGATTTAAATT
CCTAACACTTCGAACGATTTAAAAAGTGCTTTGAATTTCTCTCCTGTTTCTGTTCTTGTT
GATGCTTCTACTTGGGGCCAATATAAGTCTGGAATTTACAATGGATGTAACTAATCTAAT
ATTAGATTAAACCATGCTGTATTAGCTGTTGGCTATGACTAACAAGGTAATTGGATCGTT
AAAAATTCTTGGAGCACTAGTTGGGGTGAAAATGGCTATATTAGACTTGCTCCAAACAAC
ACATGCGGTATATTAAGCTATAATCTTTAAGTTACTGCATGA


>TTHERM_00878210(protein)
MNRFILLSIIMLMPICLTQDISVEKLLAYNRWSSQNQRVYLNEDEKLFRQMVFFENLQKI
KEHNSNPNNTYSIDVNQFSDMTQEEFTEKILMKQDLVDHQIKDIGQQATNNNDNKEMKAS
NLAIAASIDWRTKGAVTTVKNQGSCGSCWSFSAAGLMESFNFISNKALVDFSEQQLVDCV
IPANGYSSQGCNGGWPVQCLDYASKVGITTLQSYPYVAIQKKCAVTGTNNGFKPKKWIQI
PNTSNDLKSALNFSPVSVLVDASTWGQYKSGIYNGCNQSNIRLNHAVLAVGYDQQGNWIV
KNSWSTSWGENGYIRLAPNNTCGILSYNLQVTA