Identifiers and Description

Gene Model Identifier

TTHERM_00879270

Standard Name

CTH73 (CaTHepsin 73)

Aliases

PreTt09725 | 156.m00109

Description

CTH73 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF02977 ) Carboxypeptidase A inhibitor
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09209.1 2.9998177333176706e-124
Description: papain family cysteine protease containing protein (324 aa)
Oxytricha Contig322.1.g116 7.001890014428386e-55
Description: Papain family cysteine protease
WormBase WBGene00007055 6.00092892288903e-46
Description: locus:tag-196 status:Confirmed UniProt:O16454 protein_id:CCD64084.1
DictyBase DDB_G0272815 5.001531130907917e-44
Description: cprE on chromosome: 2 position 2212329 to 2213613
Stentor Coeruleus SteCoe_14922 1.2995814250075031e-24
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00879270(coding)
ATGAATAAATTTATCCTTTTGAGTATTATCATGCTCATGCCTCTCTGTTTTGCTCAAGAT
ATAAGTGTAGAAAAACTTCTTGCTTATAATAAATGGTCAAGCTAACATCAAAGAGTTTAT
CTGAATGAACATGAAAAACTATTTAGACAAATGGTTTTCTTTGAGAACATGTAAAAGATT
TAGGAACATAACAGTGATCCTAATAACACCTATTCTACCCATTTAAACTAATTCTCAGAT
ATGACTAAAGAAGAATTTGTAGAAAAAATTCTTATGAAATAGGATTTGGTTGACCATTTT
ATGAAAGGAATCAATTAAGAGACAACTCATAGTGATTCTAATAATAAGGAAACTTAATTG
AATTCAAAAAGCCTTACTTTAGCTGATTCAATAGACTGGAGAACAAAAGGTGCTGTAACA
TCAGTTAAAAATTAAGGTGATTGTGGTTCATGCTGGACTTTCTCTGCAGCTGGCTTAATG
GAGTCATTTAACTTCATTAAAAACAATGTTTTAGTTGATTTTTCTGAGTAATAACTGCTT
GACTGTGTCTACTTTACAAGGGGTTACAACTCTTATGGATGTTCTGGAGGATGGCCTGAT
TAATGTCTGAATTATGCCTCCAAAATAGGTATCACTACCCTAGACAAGTATCCCTATGTT
GGAGTTATGACCAATTGTAGAGGGAGTGGTACAAATAATGGCTTTAAGCCTAAAAGCTGG
ATTTAAATTCCTAACACTTCTAATGACTTAAAAAGTGCTTTGAATTTCTCTCCTGTTTCT
GTTCTTGTTGATGCTTCCACTTTGGGTATTTATAAATCTGGAATTTTCAACGGATGTGAT
TAATCTAATATTAGTCTTAATCACGCTGTATTAGCTGTTGGCTATGACTAACAAGGAAAC
TGGATTATTAAAAATTCTTGGGGCACCTAATGGGGTGAGAATGGCTATATGAGACTTGCT
GCTAACAATACATGCGGTATCTTAAGCTATAATTTTTAAATTACTGCTTGA


>TTHERM_00879270(gene)
ATGAATAAATTTATCCTTTTGAGTATTATCATGCTCATGCCTCTCTGTTTTGCTCAAGAT
ATAAGTGTAGAAAAACTTCTTGCTTATAATAAATGGTCAAGCTAACATCAAAGAGTTTAT
CTGAATGAACATGAAAAACTATTTAGACAAATGGTTTTCTTTGAGAACATGTAAAAGATT
TAGGAACATAACAGTGATCCTAATAACACCTATTCTACCCATTTAAACTAATTCTCAGAT
ATGACTAAAGAAGAATTTGTAGAAAAAATTCTTATGAAATAGGATTTGGTTGACCATTTT
ATGAAAGGAATCAATTAAGAGACAACTCATAGTGATTCTAATAATAAGGAAACTTAATTG
AATTCAAAAAGCCTTACTTTAGCTGATTCAATAGACTGGAGAACAAAAGGTGCTGTAACA
TCAGTTAAAAATTAAGGTGATTGTGGTTCATGCTGGACTTTCTCTGCAGCTGGCTTAATG
GAGTCATTTAACTTCATTAAAAACAATGTTTTAGTTGATTTTTCTGAGTAATAACTGCTT
GACTGTGTCTACTTTACAAGGGGTTACAACTCTTATGGATGTTCTGGAGGATGGCCTGAT
TAATGTCTGAATTATGCCTCCAAAATAGGTATCACTACCCTAGACAAGTATCCCTATGTT
GGAGTTATGACCAATTGTAGAGGGAGTGGTACAAATAATGGCTTTAAGCCTAAAAGCTGG
ATTTAAATTCCTAACACTTCTAATGACTTAAAAAGTGCTTTGAATTTCTCTCCTGTTTCT
GTTCTTGTTGATGCTTCCACTTTGGGTATTTATAAATCTGGAATTTTCAACGGATGTGAT
TAATCTAATATTAGTCTTAATCACGCTGTATTAGCTGTTGGCTATGACTAACAAGGAAAC
TGGATTATTAAAAATTCTTGGGGCACCTAATGGGGTGAGAATGGCTATATGAGACTTGCT
GCTAACAATACATGCGGTATCTTAAGCTATAATTTTTAAATTACTGCTTGA


>TTHERM_00879270(protein)
MNKFILLSIIMLMPLCFAQDISVEKLLAYNKWSSQHQRVYLNEHEKLFRQMVFFENMQKI
QEHNSDPNNTYSTHLNQFSDMTKEEFVEKILMKQDLVDHFMKGINQETTHSDSNNKETQL
NSKSLTLADSIDWRTKGAVTSVKNQGDCGSCWTFSAAGLMESFNFIKNNVLVDFSEQQLL
DCVYFTRGYNSYGCSGGWPDQCLNYASKIGITTLDKYPYVGVMTNCRGSGTNNGFKPKSW
IQIPNTSNDLKSALNFSPVSVLVDASTLGIYKSGIFNGCDQSNISLNHAVLAVGYDQQGN
WIIKNSWGTQWGENGYMRLAANNTCGILSYNFQITA