Identifiers and Description

Gene Model Identifier

TTHERM_00881370

Standard Name

CTH60 (CaTHepsin 60)

Aliases

PreTt09737 | 156.m00121

Description

CTH60 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)
  • ( TIGR00413 ) rare lipoprotein A

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09209.1 5.0008352594020174e-107
Description: papain family cysteine protease containing protein (324 aa)
Oxytricha Contig322.1.g116 2.000214949834694e-50
Description: Papain family cysteine protease
DictyBase DDB_G0272815 4.001118334825066e-42
Description: cprE on chromosome: 2 position 2212329 to 2213613
WormBase WBGene00007055 6.997646692526315e-42
Description: locus:tag-196 status:Confirmed UniProt:O16454 protein_id:CCD64084.1
Stentor Coeruleus SteCoe_14922 4.780892883885469e-25
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00881370(coding)
ATGGTTTTCTTTGAGAAATTGTAAAAGATTAATGAACATAACAACAATTCTAATAACACA
TATTCTATCCATTTAAACTAATTCTCAGATATGACTAAAGAAGAATTTACTCAAAAAATT
CTTATGAAATAGGATTTGGCTGACCATTTAATGAAAGCAGGTAGTTAAGAGGCAACTCAT
AATGATGTAAATATCGAAGCTAAACTGAATTCAAAAAACTCCACTTTAGCTACTTCAATA
GACTGGAGAACAAAAGGTGCAGTAACATCGGTTAAAAATTAAGGTAATTGTGGTTCATGC
TGGAGTTTCTCTGCAACTGGCTTAATGGAATCATTTAATTTCATTTAAAACAAAGCTTTA
GTTGAATTTTCTGAGTAATAACTCCTTGATTGTGTCACCCCTGCAAATGGTTACAGAATT
CATGGATGTGATGGAGGATGGCCTGCTTACTGTGTAGACTATGCTTCCAAAGTAGGTCTC
ACTACCTTAAAGAAATATCCCTATGTTGGAGTTTAGAATAATTGTAATGTGACAGGCACA
AATAATGGTTTTAAGCCTAAAAAGTGGAATTAAGTTCCTAACACTTCGAATGACTTAAAA
ACTGCTTTGAATTTCTCTCCTGTTTCTGTTCTTGTTGATGCTAACAATTGGGATGGTTAT
TAGTCTGGAATTTTCAACGGGTGCGATTAATCTCTTATTATTCTTAACCATGCTGTATTA
GCTGTTGGCTATGACAAACATGATAACTGGATTGTTAAAAATTCTTGGGGACCTTAATGG
GGTGAAAATGGTTATATGAGACTTGCTCCTAACAACACCTGCGGTATCCTAAAATATAAT
ATTTAAATTACTGCTTGA


>TTHERM_00881370(gene)
ATGGTTTTCTTTGAGAAATTGTAAAAGATTAATGAACATAACAACAATTCTAATAACACA
TATTCTATCCATTTAAACTAATTCTCAGATATGACTAAAGAAGAATTTACTCAAAAAATT
CTTATGAAATAGGATTTGGCTGACCATTTAATGAAAGCAGGTAGTTAAGAGGCAACTCAT
AATGATGTAAATATCGAAGCTAAACTGAATTCAAAAAACTCCACTTTAGCTACTTCAATA
GACTGGAGAACAAAAGGTGCAGTAACATCGGTTAAAAATTAAGGTAATTGTGGTTCATGC
TGGAGTTTCTCTGCAACTGGCTTAATGGAATCATTTAATTTCATTTAAAACAAAGCTTTA
GTTGAATTTTCTGAGTAATAACTCCTTGATTGTGTCACCCCTGCAAATGGTTACAGAATT
CATGGATGTGATGGAGGATGGCCTGCTTACTGTGTAGACTATGCTTCCAAAGTAGGTCTC
ACTACCTTAAAGAAATATCCCTATGTTGGAGTTTAGAATAATTGTAATGTGACAGGCACA
AATAATGGTTTTAAGCCTAAAAAGTGGAATTAAGTTCCTAACACTTCGAATGACTTAAAA
ACTGCTTTGAATTTCTCTCCTGTTTCTGTTCTTGTTGATGCTAACAATTGGGATGGTTAT
TAGTCTGGAATTTTCAACGGGTGCGATTAATCTCTTATTATTCTTAACCATGCTGTATTA
GCTGTTGGCTATGACAAACATGATAACTGGATTGTTAAAAATTCTTGGGGACCTTAATGG
GGTGAAAATGGTTATATGAGACTTGCTCCTAACAACACCTGCGGTATCCTAAAATATAAT
ATTTAAATTACTGCTTGA


>TTHERM_00881370(protein)
MVFFEKLQKINEHNNNSNNTYSIHLNQFSDMTKEEFTQKILMKQDLADHLMKAGSQEATH
NDVNIEAKLNSKNSTLATSIDWRTKGAVTSVKNQGNCGSCWSFSATGLMESFNFIQNKAL
VEFSEQQLLDCVTPANGYRIHGCDGGWPAYCVDYASKVGLTTLKKYPYVGVQNNCNVTGT
NNGFKPKKWNQVPNTSNDLKTALNFSPVSVLVDANNWDGYQSGIFNGCDQSLIILNHAVL
AVGYDKHDNWIVKNSWGPQWGENGYMRLAPNNTCGILKYNIQITA