Identifiers and Description

Gene Model Identifier

TTHERM_00881410

Standard Name

CTH95 (CaTHepsin 95)

Aliases

PreTt09741 | 156.m00125

Description

CTH95 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09209.1 6.001241942754875e-123
Description: papain family cysteine protease containing protein (324 aa)
Oxytricha Contig322.1.g116 7.000698492250867e-53
Description: Papain family cysteine protease
DictyBase DDB_G0272815 2.9986404383886433e-43
Description: cprE on chromosome: 2 position 2212329 to 2213613
WormBase WBGene00007055 5.000680012816624e-42
Description: locus:tag-196 status:Confirmed UniProt:O16454 protein_id:CCD64084.1
Stentor Coeruleus SteCoe_14922 4.780892883885469e-25
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00881410(coding)
ATGTAGATTAATTTTATTACTAAAATTATATTTTCTAATAAATAAAATTACAATTTAAGA
TAAACAATAATAAATCTGGTTAAATTTTTCTTACTGAAGAAAAATTAGTTTTTATTTATA
AAAAATTCTCTATTACAAATTGAAATTGGCTATGCTTTATATACTTAGCCATTTTTACTC
AAAACATTAAAGAATAAAAAAATAAAATAAAAAAAAATAAAAATAAAAAAAATAAAACTA
AAACTTTAATAAAGTATGAATAGATTGATCCTTTTGAGTATTATCATGCTCATGCCTCTC
TGCTTGGCTCAAGATATAAGTGTAGAAAAACTTCTTGCTTATAATAAATGGTCAAGCTAA
CACCAAAGAGTTTATCTGAATGAACATGAAAAACTATTTAGACAAATGGTTTTCTTTGAG
AACTTGTAAAAGATTTAGGAACATAACAGTGATTCTAATAACACCTATTCTGTCCATTTA
AACTAATTCTCAGATATGACTAAAGAAGAATTTGCTGAAAAAATTCTTATGAAATCTGAT
TTGGTTGACCATTTAATGAAAGGAATCAGTTAAGAGGCAACTCATAATGATACTAATAAA
GAAACTTAGTTGAATTCAAAAGGCCTTTCTTTAGCTGATTCAATAGACTGGAGAACAAAA
GGTGCTGTAACATCGGTTAAGAATTAAGGTAATTGTGGTTCATGCTGGAGTTTCTCTGCA
GCTGCAGTAATGGAGTCATTTAACTTCATTAAAAACAAAGCTTTAGTTGATTTTTCTGAG
TAATAACTTGTTGATTGTGTCATCCCTGCAAATGGTTACAACTCTTATGGATGTAGTGGA
GGATGGCCTGCTTCTTGTCTGGATTATGCCTCCAAAGTAGGTATTACTACCCTAGACAAG
TATCCCTATGTTGCAGTTTAGAAAAATTGTAATGTGACTGGTACAAATAATGGATTTAAG
CCTATAAGCTGGATTTAAATTCCTAACACTTCTAATGACTTAAAAAGTGCTTTGAATTTC
TCTCCTGTTTCTGTTGTTGTTGATGCTTCCACTTGGGGTAGTTATTATTCTGGAATTTTC
AACGGATGTGATTAATCTCATATTAGTCTTAATCATGCTGTCTTAGCTGTTGGCTATGAC
TAACAAGGAAACTGGATTATTAAAAATTCTTGGAGCACTTATTGGGGTGAAAATGGCTAT
ATGAGACTTGCTCCTAACAACACATGCGGTATCTTAAGCTATAATTATTAAGTTACTGCT
TGA


>TTHERM_00881410(gene)
ATGTAGATTAATTTTATTACTAAAATTATATTTTCTAATAAATAAAATTACAATTTAAGA
TAAACAATAATAAATCTGGTTAAATTTTTCTTACTGAAGAAAAATTAGTTTTTATTTATA
AAAAATTCTCTATTACAAATTGAAATTGGCTATGCTTTATATACTTAGCCATTTTTACTC
AAAACATTAAAGAATAAAAAAATAAAATAAAAAAAAATAAAAATAAAAAAAATAAAACTA
AAACTTTAATAAAGTATGAATAGATTGATCCTTTTGAGTATTATCATGCTCATGCCTCTC
TGCTTGGCTCAAGATATAAGTGTAGAAAAACTTCTTGCTTATAATAAATGGTCAAGCTAA
CACCAAAGAGTTTATCTGAATGAACATGAAAAACTATTTAGACAAATGGTTTTCTTTGAG
AACTTGTAAAAGATTTAGGAACATAACAGTGATTCTAATAACACCTATTCTGTCCATTTA
AACTAATTCTCAGATATGACTAAAGAAGAATTTGCTGAAAAAATTCTTATGAAATCTGAT
TTGGTTGACCATTTAATGAAAGGAATCAGTTAAGAGGCAACTCATAATGATACTAATAAA
GAAACTTAGTTGAATTCAAAAGGCCTTTCTTTAGCTGATTCAATAGACTGGAGAACAAAA
GGTGCTGTAACATCGGTTAAGAATTAAGGTAATTGTGGTTCATGCTGGAGTTTCTCTGCA
GCTGCAGTAATGGAGTCATTTAACTTCATTAAAAACAAAGCTTTAGTTGATTTTTCTGAG
TAATAACTTGTTGATTGTGTCATCCCTGCAAATGGTTACAACTCTTATGGATGTAGTGGA
GGATGGCCTGCTTCTTGTCTGGATTATGCCTCCAAAGTAGGTATTACTACCCTAGACAAG
TATCCCTATGTTGCAGTTTAGAAAAATTGTAATGTGACTGGTACAAATAATGGATTTAAG
CCTATAAGCTGGATTTAAATTCCTAACACTTCTAATGACTTAAAAAGTGCTTTGAATTTC
TCTCCTGTTTCTGTTGTTGTTGATGCTTCCACTTGGGGTAGTTATTATTCTGGAATTTTC
AACGGATGTGATTAATCTCATATTAGTCTTAATCATGCTGTCTTAGCTGTTGGCTATGAC
TAACAAGGAAACTGGATTATTAAAAATTCTTGGAGCACTTATTGGGGTGAAAATGGCTAT
ATGAGACTTGCTCCTAACAACACATGCGGTATCTTAAGCTATAATTATTAAGTTACTGCT
TGA


>TTHERM_00881410(protein)
MQINFITKIIFSNKQNYNLRQTIINLVKFFLLKKNQFLFIKNSLLQIEIGYALYTQPFLL
KTLKNKKIKQKKIKIKKIKLKLQQSMNRLILLSIIMLMPLCLAQDISVEKLLAYNKWSSQ
HQRVYLNEHEKLFRQMVFFENLQKIQEHNSDSNNTYSVHLNQFSDMTKEEFAEKILMKSD
LVDHLMKGISQEATHNDTNKETQLNSKGLSLADSIDWRTKGAVTSVKNQGNCGSCWSFSA
AAVMESFNFIKNKALVDFSEQQLVDCVIPANGYNSYGCSGGWPASCLDYASKVGITTLDK
YPYVAVQKNCNVTGTNNGFKPISWIQIPNTSNDLKSALNFSPVSVVVDASTWGSYYSGIF
NGCDQSHISLNHAVLAVGYDQQGNWIIKNSWSTYWGENGYMRLAPNNTCGILSYNYQVTA