Identifiers and Description

Gene Model Identifier

TTHERM_00895650

Standard Name

GPX5 (Glutathione PeroXidase)

Aliases

PreTt21947 | 159.m00055

Description

phospholipid hydroperoxide glutathione peroxidase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ATP-activated inward rectifier potassium channel activity (IEA) | GO:0015272

Biological Process

Domains

  • ( PF00255 ) glutathione peroxidase
  • ( PF00578 ) antioxidant, AhpC/TSA family
  • ( PF08534 ) redoxin family protein
  • ( TIGR02540 ) putative glutathione peroxidase Gpx7

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04307.1 6.002009875581486e-101
Description: glutathione peroxidase (176 aa)
WormBase WBGene00009165 8.99567666834855e-44
Description: locus:gpx-1 Glutathione peroxidase 1 status:Partially_confirmed UniProt:O02621 protein_id:CAB03004.1
Oxytricha Contig14526.0.g10 2.999884853455273e-42
Description: Glutathione peroxidase
SGD YIR037W 5.997865882830678e-40
Description: HYR1 Thiol peroxidase that functions as a hydroperoxide receptor to sense intracellular hydroperoxide levels and transduce a redox signal to the Yap1p transcription factor
Stentor Coeruleus SteCoe_40905 5.74952226429356e-19
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00895650(coding)
ATGATCAACGGTTCTGAATAAATTTAAAGCAACGCATCTAGCTTGTACGAGCTTTCCGCA
ATAGATATCAATGGCTAAAATGTTTCTTTGAAGAGCTTCAACAATAAAAAGGTTATTATT
GTTGTAAATGTAGCTTGCAAATGTGGTCTTACTTCTGATCACTATACTTAGCTTGTTGGC
TTGTACAAATAGTATAAATCCTAAGGATTAGAAGTCTTGGCTTTTCCTTGTAACTAATTT
GGTGAATAAGAACCTTGGGCTGAATCTGAAATTCTTTCATACACTCAAAAGACCTTTAAT
GTTGACTTCCCACTTTTCTCCAAAATTGATGTAAATGGTGAAAATACTCATCCTGTTTAC
AAATATTTAAGAAGAAACTCAGAACTATTTTAGAACAACTATGCAACTAAGATCCCATGG
AATTTTGCAAAATTCTTGATTGATGGAAAGACTGGCAAAGTGATTTCTTACTTCAGTCCT
AAGGTGAATCCAAACGAAATGGAGCAACAAATTAAATAACTTTTATAATGA


>TTHERM_00895650(gene)
ATGATCAACGGTTCTGAATAAATTTAAAGCAACGCATCTAGCTTGTACGAGCTTTCCGCA
ATAGATATCAATGGCTAAAATGTTTCTTTGAAGAGCTTCAACAATAAAAAGGTTATTATT
GTTGTAAATGTAGCTTGCAAATGTGGTCTTACTTCTGATCACTATACTTAGCTTGTTGGC
TTGTACAAATAGTATAAATCCTAAGGATTAGAAGTCTTGGCTTTTCCTTGTAACTAATTT
GGTGAATAAGAACCTTGGGCTGAATCTGAAATTCTTTCATACACTCAAAAGACCTTTAAT
GTTGACTTCCCACTTTTCTCCAAAATTGATGTAAATGGTGAAAATACTCATCCTGTTTAC
AAATATTTAAGAAGAAACTCAGAACTATTTTAGAACAACTATGCAACTAAGATCCCATGG
AATTTTGCAAAATTCTTGATTGATGGAAAGACTGGCAAAGTGATTTCTTACTTCAGTCCT
AAGGTGAATCCAAACGAAATGGAGCAACAAATTAAATAACTTTTATAATGA


>TTHERM_00895650(protein)
MINGSEQIQSNASSLYELSAIDINGQNVSLKSFNNKKVIIVVNVACKCGLTSDHYTQLVG
LYKQYKSQGLEVLAFPCNQFGEQEPWAESEILSYTQKTFNVDFPLFSKIDVNGENTHPVY
KYLRRNSELFQNNYATKIPWNFAKFLIDGKTGKVISYFSPKVNPNEMEQQIKQLLQ