Identifiers and Description

Gene Model Identifier

TTHERM_00895720

Standard Name

CTH83 (CaTHepsin 83)

Aliases

PreTt21954 | 159.m00062

Description

CTH83 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09217.1 9.99679536751975e-103
Description: papain family cysteine protease containing protein (342 aa)
Oxytricha Contig19008.0.g54 1.0000099287337047e-53
Description: Papain family cysteine protease
WormBase WBGene00007055 8.997207736750494e-46
Description: locus:tag-196 status:Confirmed UniProt:O16454 protein_id:CCD64084.1
DictyBase DDB_G0290957 4.000139296874041e-45
Description: cprA on chromosome: 5 position 4812963 to 4814596
Stentor Coeruleus SteCoe_29480 1.7587922024243116e-25
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00895720(coding)
ATGAATACAAAATTACTGCTTGCTATCATATTCTCAGCTTTTATCTGCTCTGCATATGCT
GATTAGGTCTCTCTTGTTGAGGCTCTTTAAGCTTATAACAAATTCACTAGAAACTACCCT
AGAATTTACTTGAACGAAGCTGAATCAGACTACAGATTGGCTATTTTCTTAGAAAATTAC
TAAAAGATTTAAGACCATAACAACAATCCTGAAAACACTTATCAAATAGGAGTTAATCGT
TTTTCTGATATGACTTAATAGGAATTTTCATAAAAGATTCTCTAAAACCCAAATATTTTA
TCAAATGGTAAAAACTATGTTCAAAAGTAACAAGCTTCTGTTAATGATGTTCAGCCTGCT
ACTTCTATTGATTGGAGAACTAAAGGAGTCGTAACTCCAGTTAAAAACTAAGGAGAGTGT
GGATCTTGCTGGGCTTTCTCTGCAACTGCTGCTATGGAATCTTATAATGCTATCCACAAC
AAAGTTCTATTAAGATTCTCAGAACAAGAATTTGTTGATTGCACTACCGAGAAAAATGGA
GGATTTTACTCTTTTGGCTGTGAAGGTGGAGTTCCTGGTGAAGCTATAAGATATGCTTCC
CTTTATGGAGTCAAGACAGAAGCAGAGTATCCTTATGTTGGAATCTAGGGATCTTGCAAT
ACCACTAACAGCACAACTACCAATTTTAAACCAGTATCATATTATTCTTTACCAGAGACA
ACCGAGGCTTTAAAAGTTGCATTGAATAATGCTCCTGTTTCTGTCTCTATTGATGCTACT
TTATTAGGAGATTACGTTTCAGGTGTTTATGATTGCAAAAATTAAACAATTGAAATTAAT
CATGCTGTATTAGCTGTTGGTTATGATGAGAAAGGTAACTGGATTCTAAAGAATTCTTGG
GCTGATGATTGGGGCTAGCAAGGGTATTTCTTATTAGCTCCTGGCAATGCTTGTGGTATC
CTAGAAACAGGTGTGGAAATTACTCCTACAAATTGA


>TTHERM_00895720(gene)
ATGAATACAAAATTACTGCTTGCTATCATATTCTCAGCTTTTATCTGCTCTGCATATGCT
GATTAGGTCTCTCTTGTTGAGGCTCTTTAAGCTTATAACAAATTCACTAGAAACTACCCT
AGAATTTACTTGAACGAAGCTGAATCAGACTACAGATTGGCTATTTTCTTAGAAAATTAC
TAAAAGATTTAAGACCATAACAACAATCCTGAAAACACTTATCAAATAGGAGTTAATCGT
TTTTCTGATATGACTTAATAGGAATTTTCATAAAAGATTCTCTAAAACCCAAATATTTTA
TCAAATGGTAAAAACTATGTTCAAAAGTAACAAGCTTCTGTTAATGATGTTCAGCCTGCT
ACTTCTATTGATTGGAGAACTAAAGGAGTCGTAACTCCAGTTAAAAACTAAGGAGAGTGT
GGATCTTGCTGGGCTTTCTCTGCAACTGCTGCTATGGAATCTTATAATGCTATCCACAAC
AAAGTTCTATTAAGATTCTCAGAACAAGAATTTGTTGATTGCACTACCGAGAAAAATGGA
GGATTTTACTCTTTTGGCTGTGAAGGTGGAGTTCCTGGTGAAGCTATAAGATATGCTTCC
CTTTATGGAGTCAAGACAGAAGCAGAGTATCCTTATGTTGGAATCTAGGGATCTTGCAAT
ACCACTAACAGCACAACTACCAATTTTAAACCAGTATCATATTATTCTTTACCAGAGACA
ACCGAGGCTTTAAAAGTTGCATTGAATAATGCTCCTGTTTCTGTCTCTATTGATGCTACT
TTATTAGGAGATTACGTTTCAGGTGTTTATGATTGCAAAAATTAAACAATTGAAATTAAT
CATGCTGTATTAGCTGTTGGTTATGATGAGAAAGGTAACTGGATTCTAAAGAATTCTTGG
GCTGATGATTGGGGCTAGCAAGGGTATTTCTTATTAGCTCCTGGCAATGCTTGTGGTATC
CTAGAAACAGGTGTGGAAATTACTCCTACAAATTGA


>TTHERM_00895720(protein)
MNTKLLLAIIFSAFICSAYADQVSLVEALQAYNKFTRNYPRIYLNEAESDYRLAIFLENY
QKIQDHNNNPENTYQIGVNRFSDMTQQEFSQKILQNPNILSNGKNYVQKQQASVNDVQPA
TSIDWRTKGVVTPVKNQGECGSCWAFSATAAMESYNAIHNKVLLRFSEQEFVDCTTEKNG
GFYSFGCEGGVPGEAIRYASLYGVKTEAEYPYVGIQGSCNTTNSTTTNFKPVSYYSLPET
TEALKVALNNAPVSVSIDATLLGDYVSGVYDCKNQTIEINHAVLAVGYDEKGNWILKNSW
ADDWGQQGYFLLAPGNACGILETGVEITPTN