Identifiers and Description

Gene Model Identifier

TTHERM_00898250

Standard Name

RRM52 (RNA recognition motif-containing protein 52)

Aliases

PreTt20530 | 160.m00066

Description

RRM52 RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor; RNA binding protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_41364.1 1.0004671766404936e-76
Description: RNA binding protein (119 aa)
Oxytricha Contig11357.0.g94 2.9994376937714457e-52
Description: RNA recognition motif_ (a_k_a_ RRM, RBD, or RNP domain)
WormBase WBGene00016808 5.997418848378574e-45
Description: Pre-mRNA branch site p14-like protein status:Confirmed UniProt:Q8ITY4 protein_id:CCD65337.1
DictyBase DDB_G0286297 2.0008536325002377e-42
Description: DDB_G0286297 on chromosome: 4 position 4322636 to 4323120
Stentor Coeruleus SteCoe_17406 2.8625185805493937e-20
Description: None
SGD YGL044C 0.0000000006000548789370351
Description: RNA15 Cleavage and polyadenylation factor I (CF I) component involved in cleavage and polyadenylation of mRNA 3 ends; interacts with the A-rich polyadenylation signal in complex with Rna14p and Hrp1p; mutant displays reduced transcription elongation in the G-less-based run-on (GLRO) assay; required for gene looping

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00898250(coding)
ATGAGCAATAAGATTGTTAAGTTACCCCCTGAGGTTAATAGAGTAGTTTATGTTAGAAAT
CTACCATATAAAATATCAGCAGAAGAATTATATGATGTTTTTGGAACTTATGGTCCAATT
AGATAAATAAGAAAGGGAGTTAGTGGTGATAAAAAAGGAACAGCATTTGTAGTTTATGAA
GATATTTTTGATGCAAAGACTGCAGTTGAACATTTAAATGGTTTTAATGTTGCAGGCAGA
TATTTAATTGTTTTATATTATCAACCTCATAAAATCAACAAAAAGACTGATTTACAAAAG
AAATAAGAAGAAGTTGATCGTTTAAAAGAAATAGCAAGCAAATAAACTTAATAGTGA


>TTHERM_00898250(gene)
ATGAGCAATAAGATTGTAAATATTAGCATTAAAAAACCAATTTTATATTCTAAAATATTT
TAATTCAAATAGGTTAAGTTACCCCCTGAGGTTAATAGAGTAGTTTATGTTAGAAATCTA
CCATATAAAATATCAGCAGAAGAATTATATGATGTTTTTGGAACTTATGGTCCAATTAGA
TAAATAAGAAAGTAAATAAATTATTTTTATTCAAATTGAAAATAGCTAATTATTTTATCA
ATATTCAATAGGGGAGTTAGTGGTGATAAAAAAGGAACAGCATTTGTAGTTTATGAAGAT
ATTTTTGATGCAAAGACTGCAGTTGAACATTTAAATGGTTTTAATGTTGCAGGCAGATAT
TTAATTGTTTTATATTATCAACCTCATAAAATCAACAAAAAGACTGATTTACAAAAGAAA
TAAGAAGAAGTTGATCGTTTAAAAGAAATAGCAAGCAAATAAACTTAATAGTGA


>TTHERM_00898250(protein)
MSNKIVKLPPEVNRVVYVRNLPYKISAEELYDVFGTYGPIRQIRKGVSGDKKGTAFVVYE
DIFDAKTAVEHLNGFNVAGRYLIVLYYQPHKINKKTDLQKKQEEVDRLKEIASKQTQQ