Identifiers and Description

Gene Model Identifier

TTHERM_00907070

Standard Name

NTP1 (Nucleoside transporter 1)

Aliases

PreTt22207 | 161.m00113

Description

NTP1 nucleoside transporter family protein; Nucleoside transporter family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00499 ) NADH-ubiquinone/plastoquinone oxidoreductase chain 6
  • ( PF01461 ) 7TM chemoreceptor
  • ( PF01733 ) Nucleoside transporter
  • ( PF03547 ) transporter, auxin efflux carrier (AEC)
  • ( PF04018 ) Domain of unknown function (DUF368)
  • ( PF07690 ) transporter, major facilitator family
  • ( TIGR00939 ) Nucleoside Transporter
  • ( TIGR01906 ) integral membrane protein TIGR01906

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_14076.1 4.999133404870476e-103
Description: nucleoside transporter (425 aa)
Oxytricha Contig3593.0.g85 0.0000000000002999981760818895
Description: Nucleoside transporter
SGD YAL022C 0.000000100009565553302
Description: FUN26 Vacuolar membrane transporter with broad nucleoside selectivity; may regulate balance of nicotinamide riboside (NmR) levels between cytosol and vacuole, contributing to salvage of NmR for use in cytosolic NAD+ synthesis
DictyBase DDB_G0283439 0.000005998506718272351
Description: DDB_G0283439 on chromosome: 4 position 699253 to 700845

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00907070(coding)
ATGGTACTTTGCTTTATCATTGGGACATTTAATTGCATTTCTTAAAATTGTAGTATAGCT
TTTATCTCTCAATTTGACAAAAGTAACCAAGGAATTTTTTGGATATTCACTTCTTTGAGT
GGGCTTTCTATGAATATTGCTAGAGCTGTTATATTAGCTATTTGTGGAAAGGATGATGAT
GGAATTACTAAAAGAACCTTGACATGTTTTATAATAGCATGCCTGATAATTTATGCTACC
ATTTTCTGTCTATTCAAATTCTTAAAATCTAAATAATATACTTATTCTCATTCTTTAAGT
ACAAGTAACTCAGAAACAGAAGTAAAAAGTCAGTTAGATAATTAAAACGATGAAATAGTT
ATTGAATTTACTGAAAATGAAGAAATTATATCCAAACCTAGCTTTAAGAGTTGCTTAATA
AGTGTTAAATACATAGCGCTCTTTCTTTTTACTAACTATGTAATCAGTTTTATGCTATTT
CCAGGAGTTTCAATATATTAAAAAAGATATTCGTTTATCGATTCGTTGGCTTGGTCGAGT
CTTATAATGTAAATTTTATTTAACCTTGGAGACTTCTTTGGGAAAATCATTAGCAGCTTT
CATTTTTATAGTTCAGTTTTGCTTTATGCTTTAACTATTTTAAGAGGCATATTTTTCTAT
ACATTTTTGATGTCTGCAAGAGAACCTGATGATTAATTCTTTGGAAATGACTATTTTGCT
ATGGTAGACATTTTTATATTTGGTCTGACACACGGCTTTGTTGCTAGCGGTCTTATGTAA
ATAGGAGCAAAGAAAAGTTTTAACCCTGAAGAAAAAAATATAATCTCTTTTATTTTGGCA
TTTTTCTTTACTTTGGGTTTATCTGCTGGTACTTTTTTAGCATTAATTCTAGAAGAACAT
TGA


>TTHERM_00907070(gene)
ATGGTACTTTGCTTTATCATTGGGACATTTAATTGCATTTCTTAAAATTGTAGTATAGCT
TTTATCTCTCAATTTGACAAAAGTAACCAAGGTATTATTAATTAACTTATATTACAAATA
AATAGCATAGTCTTAATAATTCACTAAAAAAAGGAATTTTTTGGATATTCACTTCTTTGA
GTGGGCTTTCTATGAATATTGCTAGAGCTGTTATATTAGCTATTTGTGGAAAGGATGATG
ATGGAATTACTAAAAGAACCTTGACATGTTTTATAATAGCATGCCTGATAATTTATGCTA
CCATTTTCTGTCTATTCAAATTCTTAAAATCTAAATAATATACTTATTCTCATTCTTTAA
GTACAAGTAACTCAGAAACAGAAGTAAAAAGTCAGTTAGATAATTAAAACGATGAAATAG
TTATTGAATTTACTGAAAATGAAGAAATTATATCCAAACCTAGCTTTAAGAGTTGCTTAA
TAAGTGTTAAATACATAGCGCTCTTTCTTTTTACTAACTATGTAATCAGTTTTATGCTAT
TTCCAGGAGTTTCAATATATTAAAAAAGATATTCGTTTATCGATTCGTTGGCTTGGTCGA
GGTAAATAATTCAAATCAAAACAAATTTCTTAGGACAGTTTAAATAAATATATTTTGATT
GATTGAAAGTGAAAAGGAAAATAATTAAATATTGAAAATTTTATTTTAAATAAAACATTT
ATTTAATTTTTTCAAATTAATCAAAAATTTTTATTTAGAAATTAAAATCTTTAAGTGAAA
GAAAAAAGAAGAATAAATCAATTATTTAAATAATATATTAATCACGTTTCAAGCTAATCG
TAATTTTTAAATAAATAGTCTTATAATGTAAATTTTATTTAACCTTGGAGACTTCTTTGG
GAAAATCATTAGCAGCTTTCATTTTTATAGTTCAGTTTTGCTTTATGCTTTAACTATTTT
AAGAGGCATATTTTTCTATACATTTTTGATGTCTGCAAGAGAACCTGATGATTAATTCTT
TGGAAATGACTATTTTGCTATGGTAGACATTTTTATATTTGGTCTGACACACGGCTTTGT
TGCTAGCGGTCTTATGTAAATAGGAGCAAAGAAAAGTTTTAACCCTGAAGAAAAAAATAT
AATCTCTTTTATTTTGGCATTTTTCTTTACTTTGGGTTTATCTGCTGGTACTTTTTTAGC
ATTAATTCTAGAAGAACATTGA


>TTHERM_00907070(protein)
MVLCFIIGTFNCISQNCSIAFISQFDKSNQGIFWIFTSLSGLSMNIARAVILAICGKDDD
GITKRTLTCFIIACLIIYATIFCLFKFLKSKQYTYSHSLSTSNSETEVKSQLDNQNDEIV
IEFTENEEIISKPSFKSCLISVKYIALFLFTNYVISFMLFPGVSIYQKRYSFIDSLAWSS
LIMQILFNLGDFFGKIISSFHFYSSVLLYALTILRGIFFYTFLMSAREPDDQFFGNDYFA
MVDIFIFGLTHGFVASGLMQIGAKKSFNPEEKNIISFILAFFFTLGLSAGTFLALILEEH