Identifiers and Description

Gene Model Identifier

TTHERM_00908100

Standard Name

CTH44 (CaTHepsin 44)

Aliases

PreTt23713 | 162.m00042

Description

CTH44 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_06182.1 3.001476460448119e-154
Description: papain family cysteine protease containing protein (345 aa)
Oxytricha Contig13288.0.g37 6.996899116468003e-76
Description: Papain family cysteine protease
DictyBase DDB_G0272298 1.9992362000979228e-56
Description: DDB_G0272298 on chromosome: 2 position 1664020 to 1665049
WormBase WBGene00000776 1.0000099287337047e-53
Description: locus:cpl-1 status:Confirmed UniProt:O45734 protein_id:CAB07275.1
Stentor Coeruleus SteCoe_29480 1.1089390193121365e-40
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00908100(coding)
ATGAGAAATATCATTTTCTTAACTTTATCAGCTTTGTGCTTAAGTGCAGTTATTGCTTAA
GATTCAAATCAAGAAATTTTAATATCTAGAGGGCTAGTTGATTATACTGATGCAGATCTT
CTAAGTATTTACTAATCTTATGGATACGAGCCTGATCCAAGTAGCGAAAGGTTTTAGCTT
TTTAAAAGTAGATTAGCTAAGATAATTGAACACAACTCTAATCCTGATAAAAAATACAGT
TAAAAAATCAACAAACTTACTTTCTAGACTGGTTCAGAACTAAAGAAGTTTAGAGCTTCA
TAAAATTGCTCAGCTACTGCTTAGGCAAACACCCGTTCATTCAGAAAATATGACTTGAGT
TAACTCCCTTAATATGTTGATTGGAGAGAGAAAGGAGTTGTAACTTAGGTTAAAAATTAA
GGTGAAGATTGTGGTTCATGTTGGGCATTTGCAGCTGTTGCAGCTCTTGAATCTCATTAT
GCTTTAAAAACTGGTAAAAAGCCAATTTAATTTTCTGAGTAGCAACTTGTTGATTGTGCT
AGAAAATTTGATACCCAAGGTTGCGATGGTGGATTACCTTCCAAAGGTTTTGAATATTTA
GCTTATGCTGGAGGAATTTAAACTGAAGCTGATTATCCTTATGAAGGAAAGGATAAAAAA
TGCAGATTTAATAGCTCAAAGGCTGTAGCTTAGGTCGAAAAATCCTTTAATATAACATTT
TAAGATGAGAATGAATTGATTTATCATTTAGCTAACTATGGTCCAGTTGCAATAGCTTAT
GAAGTTAATGATGATTTTGATAACTATGAAGATGGTGTCTTTACAAGTTCTAATTGCTCT
ACTGATCCAGAAGATGTTAATCATGCAGTTCTTGCAGTTGGCTACAATATGACAGGTAAG
TACTTCATAGTTAAAAATAGCTGGGGTAAAGATTGGGGAATGAATGGTTACTTCTATATC
GAACTTGGATCAAATATGTGTGGATTAGCAGATTGTGCAAGCTATCCTATTATTGATGAA
GACGATGATGATGAAGCCGACAAACATGATTGA


>TTHERM_00908100(gene)
ATGAGAAATATCATTTTCTTAACTTTATCAGCTTTGTGCTTAAGTGCAGTTATTGCTTAA
GATTCAAATCAAGAAATTTTAATATCTAGAGGGCTAGTTGATTATACTGATGCAGATCTT
CTAAGTATTTACTAATCTTATGGATACGAGCCTGATCCAAGTAGCGAAAGGTTTTAGCTT
TTTAAAAGTAGATTAGCTAAGATAATTGAACACAACTCTAATCCTGATAAAAAATACAGT
TAAAAAATCAACAAACTTACTTTCTAGACTGGTTCAGAACTAAAGAAGTTTAGAGCTTCA
TAAAATTGCTCAGCTACTGCTTAGGCAAACACCCGTTCATTCAGAAAATATGACTTGAGT
TAACTCCCTTAATATGTTGATTGGAGAGAGAAAGGAGTTGTAACTTAGGTTAAAAATTAA
GGTGAAGGTAAAACTAATTTTAATATATTTTTATATTATATTATAAATGTACTAATATTT
ATGTAATAATATTAGATTGTGGTTCATGTTGGGCATTTGCAGCTGTTGCAGCTCTTGAAT
CTCATTATGCTTTAAAAACTGGTAAAAAGCCAATTTAATTTTCTGAGTAGCAACTTGTTG
ATTGTGCTAGAAAATTTGATACCCAAGGTTGCGATGGTGGATTACCTTCCAAAGGTTTTG
AATATTTAGCTTATGCTGGAGGAATTTAAAGTAATTTACTTTAATTTAATTTAGGAATTA
TTTATTTAATTTAAGATATTAATAATTTTATATATTTTTTATATAAATATTTTAATATAT
TAGCTGAAGCTGATTATCCTTATGAAGGAAAGGATAAAAAATGCAGATTTAATAGCTCAA
AGGCTGTAGCTTAGGTCGAAAAATCCTTTAATATAACATTTTAAGATGAGAATGAATTGA
TTTATCATTTAGCTAACTATGGTCCAGTTGCAATAGCTTATGAAGTTAATGATGATTTTG
ATAACTATGAAGATGGTGTCTTTACAAGTTCTAATTGCTCTACTGATCCAGAAGATGTTA
ATCATGCAGTTCTTGCAGTTGGCTACAATATGACAGGTAAGTACTTCATAGTTAAAAATA
GCTGGGGTAAAGATTGGGGAATGAATGGTTACTTCTATATCGAACTTGGATCAAATATGT
GTGGATTAGCAGATTGTGCAAGCTATCCTATTATTGATGAAGACGATGATGATGAAGCCG
ACAAACATGATTGA


>TTHERM_00908100(protein)
MRNIIFLTLSALCLSAVIAQDSNQEILISRGLVDYTDADLLSIYQSYGYEPDPSSERFQL
FKSRLAKIIEHNSNPDKKYSQKINKLTFQTGSELKKFRASQNCSATAQANTRSFRKYDLS
QLPQYVDWREKGVVTQVKNQGEDCGSCWAFAAVAALESHYALKTGKKPIQFSEQQLVDCA
RKFDTQGCDGGLPSKGFEYLAYAGGIQTEADYPYEGKDKKCRFNSSKAVAQVEKSFNITF
QDENELIYHLANYGPVAIAYEVNDDFDNYEDGVFTSSNCSTDPEDVNHAVLAVGYNMTGK
YFIVKNSWGKDWGMNGYFYIELGSNMCGLADCASYPIIDEDDDDEADKHD