Identifiers and Description

Gene Model Identifier

TTHERM_00910100

Standard Name

CTH53 (CaTHepsin 53)

Aliases

PreTt23715 | 162.m00044

Description

CTH53 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_06182.1 1.9992336839414155e-150
Description: papain family cysteine protease containing protein (345 aa)
Oxytricha Contig1254.0.g80 1.0004671766404936e-76
Description: Papain family cysteine protease
DictyBase DDB_G0272298 2.999948199478294e-54
Description: DDB_G0272298 on chromosome: 2 position 1664020 to 1665049
WormBase WBGene00000776 9.998397555368434e-52
Description: locus:cpl-1 status:Confirmed UniProt:O45734 protein_id:CAB07275.1
Stentor Coeruleus SteCoe_29480 4.0795586671775603e-41
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00910100(coding)
ATGAGAAATATCATTTTCTTAACTTTATCAGCTTTGTGCTTAAGTGCAGTTATTGCTTAA
GATTCAAATCAAGAAATATTAATATCTAGAGGGCTAGTTGATTATACTGATGCAGATCTT
CTAAGTATTTACTAATCTTATGGTTATGAGCCTGATCCAAACAGCGAAAGATTTTAGCTT
TTTAAAAGTAGATTAGCTAAGATAATTGAACATAACTCTAATCCTGATAAAAAATACAGT
TAAATTATCAACAAGCTTACTTTCTAAACTGATTTAGAATTAAAGAAATTTAGAGCTTCA
TAAAATTGCTCAGCTACTGCTTAAGCAAACACCCGTTCATTCAGAAAATATGACTTGAGT
TAACTCCCTTAATATGTTGATTGGAGAGAGAAAGGAGTTGTAACTTAGGTTAAGAGTTAA
GGTAAAGATTGTGGTTCATGTTGGGCATTTGCAGCTGTTGCAGCTCTTGAATCTCATTAT
GCTTTAAAAACTGGTAAAAAGCCAATTTAATTTTCTGAGTAGCAACTTGTTGATTGTGCT
AGAAAATTTGATACTAAAGGTTGTAGTGGTGGATTACCTTCCAAAGGTTTTGAATATTTA
GCTTATGCTGGGGGAATTTAAAATGAAGCTGATTATCCTTATGAAGGAGAGGATAAAAAT
TGCAGATTTAATAGCTCAAAGACTGTTGTTTAGGTCTAAAAATCCTATAATATAACATTT
TAAGATGAGAATGAATTGATTTATCATTTAGCTAACTATGGTCCAGTTACTATAGCTTAT
TAAGTTAATAGTGATTTTGATAACTATAAAAATGGCGTCTTTACAAGTTCTAATTGCTCT
AAAGATCCAGAAGATGTTAATCATGCTGTTCTTGCAGTTGGCTACAATATGACAGGTAAG
TACTTCATTGCTAAAAATAGCTGGGGTAACGATTGGGGAATGAATGGCTACTTCTATATC
GAACTTGGATCAAATATGTGTGGCTTAGCAGATTGTGCAAGCTATCCTATTATTGGTGAA
GAAGTTAATAATAATGATAATGATGAAGCCGACAAACATGATTGA


>TTHERM_00910100(gene)
ATGAGAAATATCATTTTCTTAACTTTATCAGCTTTGTGCTTAAGTGCAGTTATTGCTTAA
GATTCAAATCAAGAAATATTAATATCTAGAGGGCTAGTTGATTATACTGATGCAGATCTT
CTAAGTATTTACTAATCTTATGGTTATGAGCCTGATCCAAACAGCGAAAGATTTTAGCTT
TTTAAAAGTAGATTAGCTAAGATAATTGAACATAACTCTAATCCTGATAAAAAATACAGT
TAAATTATCAACAAGCTTACTTTCTAAACTGATTTAGAATTAAAGAAATTTAGAGCTTCA
TAAAATTGCTCAGCTACTGCTTAAGCAAACACCCGTTCATTCAGAAAATATGACTTGAGT
TAACTCCCTTAATATGTTGATTGGAGAGAGAAAGGAGTTGTAACTTAGGTTAAGAGTTAA
GGTAAAGGTAAAGCTAATTTTAATATATTTTTATATTATAAATATACTAATATTTATGTA
ATAATATTAGATTGTGGTTCATGTTGGGCATTTGCAGCTGTTGCAGCTCTTGAATCTCAT
TATGCTTTAAAAACTGGTAAAAAGCCAATTTAATTTTCTGAGTAGCAACTTGTTGATTGT
GCTAGAAAATTTGATACTAAAGGTTGTAGTGGTGGATTACCTTCCAAAGGTTTTGAATAT
TTAGCTTATGCTGGGGGAATTTAAAGTAATTTACTTTACTTTATTTTAGGAATTATTTAT
TAAATTTAAGATATTTAATAATTTTATATATTTAATATAATTATTTTAATATTTTAGATG
AAGCTGATTATCCTTATGAAGGAGAGGATAAAAATTGCAGATTTAATAGCTCAAAGACTG
TTGTTTAGGTCTAAAAATCCTATAATATAACATTTTAAGATGAGAATGAATTGATTTATC
ATTTAGCTAACTATGGTCCAGTTACTATAGCTTATTAAGTTAATAGTGATTTTGATAACT
ATAAAAATGGCGTCTTTACAAGTTCTAATTGCTCTAAAGATCCAGAAGATGTTAATCATG
CTGTTCTTGCAGTTGGCTACAATATGACAGGTAAGTACTTCATTGCTAAAAATAGCTGGG
GTAACGATTGGGGAATGAATGGCTACTTCTATATCGAACTTGGATCAAATATGTGTGGCT
TAGCAGATTGTGCAAGCTATCCTATTATTGGTGAAGAAGTTAATAATAATGATAATGATG
AAGCCGACAAACATGATTGA


>TTHERM_00910100(protein)
MRNIIFLTLSALCLSAVIAQDSNQEILISRGLVDYTDADLLSIYQSYGYEPDPNSERFQL
FKSRLAKIIEHNSNPDKKYSQIINKLTFQTDLELKKFRASQNCSATAQANTRSFRKYDLS
QLPQYVDWREKGVVTQVKSQGKDCGSCWAFAAVAALESHYALKTGKKPIQFSEQQLVDCA
RKFDTKGCSGGLPSKGFEYLAYAGGIQNEADYPYEGEDKNCRFNSSKTVVQVQKSYNITF
QDENELIYHLANYGPVTIAYQVNSDFDNYKNGVFTSSNCSKDPEDVNHAVLAVGYNMTGK
YFIAKNSWGNDWGMNGYFYIELGSNMCGLADCASYPIIGEEVNNNDNDEADKHD