Identifiers and Description

Gene Model Identifier

TTHERM_00918460

Standard Name

MED11 (Mediator subunit 11)

Aliases

PreTt07041 | 163.m00043 | 3754.m00249

Description

hypothetical protein; Subunit 11 of transcriptional regulator Mediator complex. Co-purified with Med31 in AP-MS experiments.

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_20569 0
Description: None
Tetrahymena borealis EI9_19171.1 3.0011931572567413e-53
Description: hypothetical protein (138 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:31280994: Garg J, Saettone A, Nabeel-Shah S, Cadorin M, Ponce M, Marquez S, Pu S, Greenblatt J, Lambert JP, Pearlman RE, Fillingham J (2019) The Med31 Conserved Component of the Divergent Mediator Complex in Tetrahymena thermophila Participates in Developmental Regulation. Current biology : CB 29(14):2371-2379.e6

Sequences

>TTHERM_00918460(coding)
ATGGATGTTTAGGAGAATTTAAGCTAGAATTAGCAGGTCAATTACTTTAAGAGTAAATTG
ACTGATTTAAAATAATTTAAGAAATAACTTGAAGAAGCATACAATGATAAAAGTACAACC
TACCTATAAAAGAATGATAAATTCTTTGCAATTATAAACGATTACAAGCAATAACTTGAA
GATATATAAAAAATAATAGAAGAAGATATAGTTAATGTGAATGCTCCTAACATACCTGAA
GAGCTAATTAAACGCTAAGATTAAGATTAAAGTATTAAGGAGTATATGTAAGAAAGAAAA
GAATTAGTAAAGAAAAGTATAGATGGATAAAAAGAAAAACTATAGTTTATTTAAAATTTT
ACAAATGAATTTGAGAAGAGTTTAAAAGAGTATAAAATTTTACCTGATTCTTGA


>TTHERM_00918460(gene)
ATGGATGTTTAGGAGAATTTAAGCTAGAATTAGCAGGTCAATTACTTTAAGAGTAAATTG
ACTGATTTAAAATAATTTAAGAAATAACTTGAAGAAGCATACAATGATAAAAGTACAACC
TACCTATAAAAGAATGATAAATTCTTTGCAATTATGTATGTTGAAGCATATTTAATTATA
ATAATTAGAGATTTATTTTTTATAAAAAATAAGAAACGATTACAAGCAATAACTTGAAGA
TATATAAAAAATAATAGAAGAAGATATAGTTAATGTGAATGCTCCTAACATACCTGAAGA
GCTAATTAAGTAATTAAATTTATTTTATTTGGATAAAATAAACAAATAATCTTTAATACT
AATAGACGCTAAGATTAAGATTAAAGTATTAAGGAGTATATGTAAGAAAGAAAAGAATTA
GTAAAGAAAAGTATAGATGGATAAAAAGAAAAACTATAGTTTATTTAAAATTTTACAAAT
GAATTTGAGAAGAGTTTAAAAGAGTATAAAATTTTACCTGATTCTTGA


>TTHERM_00918460(protein)
MDVQENLSQNQQVNYFKSKLTDLKQFKKQLEEAYNDKSTTYLQKNDKFFAIINDYKQQLE
DIQKIIEEDIVNVNAPNIPEELIKRQDQDQSIKEYMQERKELVKKSIDGQKEKLQFIQNF
TNEFEKSLKEYKILPDS