Identifiers and Description

Gene Model Identifier

TTHERM_00923000

Standard Name

ALT2 (Alpha-Like Tubulin 2)

Aliases

PreTt21179 | 164.m00072

Description

ALT2 tubulin/FtsZ family GTPase domain protein; Alpha-tubulin-like protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886

Biological Process

Domains

  • ( PF00091 ) Tubulin/FtsZ family, GTPase domain
  • ( PF03953 ) tubulin/FtsZ family, C-terminal domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_19838.1 1.9995739544551218e-152
Description: tubulin/FtsZ family, GTPase domain-containing protein (460 aa)
WormBase WBGene00006529 4.999238967328776e-115
Description: locus:tba-2 Tubulin alpha-2 chain status:Confirmed UniProt:P34690 protein_id:CAB16856.1
Oxytricha Contig21024.0.g66 5.001313616964319e-114
Description: Tubulin/FtsZ family, GTPase domain
DictyBase DDB_G0287689 2.0007666164339447e-112
Description: tubA on chromosome: 5 position 707217 to 708704
SGD YML085C 3.0014466598835893e-101
Description: TUB1 Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules
Stentor Coeruleus SteCoe_14841 1.5400882849875202e-51
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00923000(coding)
ATGAAATAAATTATTACCATTTGCTTAGGCTAATGTGGAATAAGAATTGGTAATTAAGTA
TGGAAATTATTTTGTGAAGAGCATAAAATTGAATTATCTGGGATAAAAAAATAGTCTGAA
AACACCTTAGAATAAGAAAACTTATTATCATTTTTTTAAGAAAGTGTATCAGAAAAAATA
ACACCTATTTCAGTTTTTATCGATTTAGATACAGAATAAATTGATGAAATAAAAAATGGT
TAGTGTAGGACACTTTACAAACCTGATTGTCTTATATCATCTAAAGAAGATACTGGAGGC
CTTTTTTCAAGAGGTTATTATACAGCTGGTAGGTCTATTTTAGATCATTCTATTGATTAA
ATACGTAAAATTGCTGAAAGCTGTAGCTACTTGCATGGTTTTATAATTTATTCAACTTCA
AGTGGAGGAGCTTCTTCAGGATTAGGAAATTTAATTTTATAACGCCTTAGAGTTGATTAT
GGTTAAAAAATACCTATCATATTTTTTTAATAAATTCCATGCAATTTAAACTAATCTTCA
GTATTTTCGTTTTATAACTCAACTTTAAATTTAGGCAGCTTACTTGAGGAATCAAGCTTA
AATATTTTATTCTAAAATGAATCTTTGTATAAAATATATGAAAATTAGTTTGATTTTGAA
TATCCATCATTTAATGATGTCAATCGCTTAGTTTCATAAGTAGCATCGGCAACTACAAGT
TCTATCAGATTTAAAGGCGATCTAAATTTTGATCTTAATTAATTGATTATGAATTTGGTA
CCATACCGTAAAATAAATTTAGTTATTCCTTCATATTCTCCTTCGACTGATAAAAATAAT
TAACAAAACTAGTAAATGAGTGTAAATAGTATGACTAATTAGCTTTTTAAAAATGATTTT
AGTTTTATCAATTGTAAAATTAATGCAAATATATACATGGCTTGTTCATATATGATCAGA
GGAGATATAGTGCCAAGAGAAGCACTAGAGTCGATATATAATTTAAAAAAAAAGAAAAAT
ATTAAATTTGTTGATTGGTGTTCTAATAGCTTTTTGCTAGGAGTTAACTCATTTAAACCT
ATTCCTATCATAATCGAAGAAAAATCTTTCTCTTCTTCAGTAGATGGTTGCATTTTAGCT
AATAGCTGTGGTGTATAAGATGCTATAGATTTTATTGGTACCAAATTTGATTTAATGTAT
TCTAAAAGAGCTTTTGTTCATTGGCATTACGGTGAAGGCCAAAGTGAAGGCGATCTACAA
GAAGCAAGAGAAATTTTAGCTTCAATAGAAAAAGACTATGAAGAAATTTCAAAAGATTCT
TATACATTATAGTTAGAGGAAGATTATGAATGA


>TTHERM_00923000(gene)
ATGAAATAAATTATTACCATTTGCTTAGGCTAATGTGGAATAAGAATTGGTAATTAAGTA
TGGAAATTATTTTGTGAAGAGCATAAAATTGAATTATCTGGGATAAAAAAATAGTCTGAA
AACACCTTAGAATAAGAAAACTTATTATCATTTTTTTAAGAAAGTGTATCAGAAAAAATA
ACACCTATTTCAGTTTTTATCGATTTAGATACAGAATAAATTGATGAAATAAAAAATGGT
TAGTGTAGGACACTTTACAAACCTGATTGTCTTATATCATCTAAAGAAGATACTGGAGGC
CTTTTTTCAAGAGGTTATTATACAGCTGGTAGGTCTATTTTAGATCATTCTATTGATTAA
ATACGTAAAATTGCTGAAAGCTGTAGCTACTTGCATGGTTTTATAATTTATTCAACTTCA
AGTGGAGGAGCTTCTTCAGGATTAGGAAATTTAATTTTATAACGCCTTAGAGTTGATTAT
GGTTAAAAAATACCTATCATATTTTTTTAATAAATTCCATGCAATTTAAACTAATCTTCA
GTATTTTCGTTTTATAACTCAACTTTAAATTTAGGCAGCTTACTTGAGGAATCAAGCTTA
AATATTTTATTCTAAAATGAATCTTTGTATAAAATATATGAAAATTAGTTTGATTTTGAA
TATCCATCATTTAATGATGTCAATCGCTTAGTTTCATAAGTAGCATCGGCAACTACAAGT
TCTATCAGATTTAAAGGCGATCTAAATTTTGATCTTAATTAATTGATTATGAATTTGGTA
CCATACCGTAAAATAAATTTAGTTATTCCTTCATATTCTCCTTCGACTGATAAAAATAAT
TAACAAAACTAGTAAATGAGTGTAAATAGTATGACTAATTAGCTTTTTAAAAATGATTTT
AGTTTTATCAATTGTAAAATTAATGCAAATATATACATGGCTTGTTCATATATGATCAGA
GGAGATATAGTGCCAAGAGAAGCACTAGAGTCGATATATAATTTAAAAAAAAAGAAAAAT
ATTAAATTTGTTGATTGGTGTTCTAATAGCTTTTTGCTAGGAGTTAACTCATTTAAACCT
ATTCCTATCATAATCGAAGAAAAATCTTTCTCTTCTTCAGTAGATGGTTGCATTTTAGCT
AATAGCTGTGGTGTATAAGATGCTATAGATTTTATTGGTACCAAATTTGATTTAATGTAT
TCTAAAAGAGCTTTTGTTCATTGGCATTACGGTGAAGGCCAAAGTGAAGGCGATCTACAA
GAAGCAAGAGAAATTTTAGCTTCAATAGAAAAAGACTATGAAGAAATTTCAAAAGATTCT
TATACATTATAGTTAGAGGAAGATTATGAATGA


>TTHERM_00923000(protein)
MKQIITICLGQCGIRIGNQVWKLFCEEHKIELSGIKKQSENTLEQENLLSFFQESVSEKI
TPISVFIDLDTEQIDEIKNGQCRTLYKPDCLISSKEDTGGLFSRGYYTAGRSILDHSIDQ
IRKIAESCSYLHGFIIYSTSSGGASSGLGNLILQRLRVDYGQKIPIIFFQQIPCNLNQSS
VFSFYNSTLNLGSLLEESSLNILFQNESLYKIYENQFDFEYPSFNDVNRLVSQVASATTS
SIRFKGDLNFDLNQLIMNLVPYRKINLVIPSYSPSTDKNNQQNQQMSVNSMTNQLFKNDF
SFINCKINANIYMACSYMIRGDIVPREALESIYNLKKKKNIKFVDWCSNSFLLGVNSFKP
IPIIIEEKSFSSSVDGCILANSCGVQDAIDFIGTKFDLMYSKRAFVHWHYGEGQSEGDLQ
EAREILASIEKDYEEISKDSYTLQLEEDYE