Identifiers and Description

Gene Model Identifier

TTHERM_00924320

Standard Name

GST61 (Glutathione S-transferase omega 7, TtGSTo7, GSTo7)

Aliases

PreTt21212 | 164.m00105

Description

GST61 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF00462 ) Glutaredoxin
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain
  • ( TIGR01262 ) maleylacetoacetate isomerase
  • ( TIGR02182 ) glutaredoxin, GrxB family
  • ( TIGR02196 ) Glutaredoxin-like protein, YruB-family

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_13218.1 4.0006013729588566e-158
Description: glutathione S-transferase domain-containing protein (270 aa)
WormBase WBGene00001790 0.00000000007999955850159168
Description: locus:gst-42 Probable maleylacetoacetate isomerase status:Confirmed UniProt:Q18938 protein_id:CAA91449.1
DictyBase DDB_G0276351 0.00000000019994075865167896
Description: DDB_G0276351 on chromosome: 2 position 6703448 to 6704140
Oxytricha Contig19947.0.g22 0.000000000500206551404915
Description: Glutathione S-transferase, N-terminal domain
SGD YNL229C 0.000009999254677478949
Description: URE2 Nitrogen catabolite repression transcriptional regulator that acts by inhibition of GLN3 transcription in good nitrogen source; has glutathione peroxidase activity and can mutate to acquire GST activity; altered form creates [URE3] prion

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00924320(coding)
ATGGATATTACTGCTACTAACGAACCTGTAAGATTCTACTGCTTTGTTACTTGTCCTTAC
GCCATCAGGGTAAGAACCGCTTTAGAACTCCTCTAAGTACCATATGAATATAATGAAATT
GATCTATTGACTATATCAGAAAGCTTGGTCTGCTTAGAGTATCTCAATGATAAATACTAA
CCTGGCTTGCTTCCTTAAGACAGTTTCTAAAGAGCCCAAATCAGAAAATGGATCACATAT
TATAGTTCTATTGACGCAAAGAAATGGAGAATTTTAGGTGCTATTAGAAACAAAAATAAA
GAAGAAGCTTATCGTATTCTAAATGAAATTTAATAAAATTTAAAATTCTTGTCATCTTAA
ATTGATTTGCCAATTAGAGTTGAATAAAATTCAAAAACCTTCTTGTTTGGTTCTACTTTT
GGGATGGGTGATATTGCTATTCTACCAGTTTTAGATTAAATGATTATATTATTTGAAACT
GCATTTGGAAAGCATATTTTAAAAGATAATTTGAATGGAAAAGATGTTGATGCACTAAAA
GCACTTTATATTTGGTTTGAAAATACCAAATAGTAACCTGCATACTAAAAGTCAACATAC
AAGCTTTAGAGTCTACCATAAAATCCTCTAATTGATGAACTTAACTTAAGAAATAACTGG
CAATTCGATAAATATTACATAAACTTTGCATAAAGAAAGTTCTTCCCTAGTGGTTAAATC
CCAAAATTATGA


>TTHERM_00924320(gene)
ATGGATATTACTGCTACTAACGAACCTGTAAGATTCTACTGCTTTGTTACTTGTCCTTAC
GCCATCAGGGTAAGAACCGCTTTAGAACTCCTCTAAGTACCATATGAATATAATGAAATT
GATCTATTGGTAAATTAATAACTTACTCCTGAGTTCCTAAAAATAAATCCCCTCCATTAA
GTACCAGTGATTATTAACAAGCAAGGATAGGTAGATTATAAATATTCTTATAATTAAATG
TAATTTATTATTTTATTAGACTATATCAGAAAGCTTGGTCTGCTTAGAGTATCTCAATGA
TAAATACTAACCTGGCTTGCTTCCTTAAGACAGTTTCTAAAGAGCCCAAATCAGAAAATG
GATCACATATTATAGTTCTATTGACGCAAAGAAATGGAGAATTTTAGGTGCTATTAGAAA
CAAAAATAAAGAAGAAGCTTATCGTATTCTAAATGAAATTTAATAAAATTTAAAATTCTT
GTCATCTTAAATTGATTTGCCAATTAGAGTTGAATAAAATTCAAAAACCTTCTTGTTTGG
TTCTACTTTTGGGATGGGTGATATTGCTATTCTACCAGTTTTAGATTAAATGATTATATT
ATTTGAAACTGCATTTGGAAAGTAATTTTATTTTTTAAAATGTTTAATTTTTTGTAAAAT
AAATATCTAACTTTTTTATTTTTTAAGGCATATTTTAAAAGATAATTTGAATGGAAAAGA
TGTTGATGCACTAAAAGCACTTTATATTTGGTTTGAAAATACCAAATAGTAACCTGCATA
CTAAAAGTCAACATACAAGCTTTAGAGTCTACCATAAAATCCTCTAATTGATGAACTTAA
CTTAAGAAATAACTGGCAATTCGATAAATATTACATAAACTTTGCATAAAGAAAGTTCTT
CCCTAGTGGTTAAATCCCAAAATTATGA


>TTHERM_00924320(protein)
MDITATNEPVRFYCFVTCPYAIRVRTALELLQVPYEYNEIDLLTISESLVCLEYLNDKYQ
PGLLPQDSFQRAQIRKWITYYSSIDAKKWRILGAIRNKNKEEAYRILNEIQQNLKFLSSQ
IDLPIRVEQNSKTFLFGSTFGMGDIAILPVLDQMIILFETAFGKHILKDNLNGKDVDALK
ALYIWFENTKQQPAYQKSTYKLQSLPQNPLIDELNLRNNWQFDKYYINFAQRKFFPSGQI
PKL