Identifiers and Description

Gene Model Identifier

TTHERM_00925560

Standard Name

SNF12

Aliases

PreTt04363 | 165.m00081 | 3747.m00334

Description

SWIB/MDM2 domain protein; Member of the SWI/SNF complex.

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20685.1 9.997093137033517e-262
Description: SWIB/MDM2 domain-containing protein (558 aa)
WormBase WBGene00044072 6.99697739292434e-35
Description: locus:ham-3 status:Confirmed UniProt:Q09646 protein_id:CAA87424.1
DictyBase DDB_G0273725 1.9991517704232713e-32
Description: snf12-2 on chromosome: 2 position 3329319 to 3330893
Oxytricha Contig940.0.g8 8.000721090200152e-18
Description: SWIB/MDM2 domain
Stentor Coeruleus SteCoe_28765 0.00000000003775134544279098
Description: None
SGD YOR295W 0.000019995566179747357
Description: UAF30 Subunit of UAF (upstream activation factor), which is an RNA polymerase I specific transcription stimulatory factor composed of Uaf30p, Rrn5p, Rrn9p, Rrn10p, histones H3 and H4; deletion decreases cellular growth rate

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00925560(coding)
ATGTAAAATTAATAGGTAAATCCAGCAGCTGGCATGAGTGCTCCTTAAAACCCAAATATG
ATGAATGGCTAGTAACGCCCCTTGGGACCTCCCTAGCCCTAAGGACACTTTTAAAGAAAT
TAGATGGCTAATCCTCAAGGACAAGGAGGAATGGGAGGAAATTAATAAGGTGTAATTTAT
GGATAAGGTGGATAATAAGGCCACCCACAATAGCAAATTATGAGTTAATAATAAGGAGTT
TAGCCAAATCAATAATAAAATATTCCATAGTAATAACAGCAGCAATAAGGTTCATAATCG
CACGCAGCATAAGAAAGTTATATTGACCCAAAATAGCTGATTCATTCGATTTATGAAAAG
GGTAATATTGGGTATTCTGAGTGTGATGAAGAATTATTAAAAATAGCCCCAGAATTTGAA
TTACTTAATTAGCTTGTTAAATATGAAGGAATGATTGATAAAATGGTGAAAAGAAAGAGA
TTCGATTTACAGGAATAGTTTGCAAGACCAAATTAAAAGACAAAACAAATATTCAGAATG
TACATTACTAATGACTATACTTTAGTACCTTAGGGACCTCATATAGATAATGATCCCATG
CAAATTGAATAAGAAGAACAATATATATGGAATCTTAAAATATATGGACATTTGCTTTAA
GAAGACAAGACTAACGCATCATATTTGACAACTCCTAAGCAATATTTTTCAAATTTCTTC
TCAAAAATCACTGTAGAATTCAAGGATCCTCTTTTCAGCAGCGAACCCGTTTAATGGAGA
AAGTCAGATAAGGTAGAGTAGGGAATAATCATTCGCAAATAAAGCAGCAAGGAAACAGTA
GTTACAATTCATATTCATTTGTATCACAACCCTTTGAAGTTTAGAGTTGATCCTAAGCTC
GCTTCAATTATTGGGTTTGAAATTTGCACTAGATCAACTGCTTTGGCTGCTATTTGGGAA
TATATTAAGCTTAAAAATTTGTAAGACAGTGAAAATAAAAGTGAGATAAATTGTGATGAT
GCGATGAGAAGCGTATTCTTACAAGACAAAATAAACATAGGACAAATCACAGCAAAATTG
AGATAACTCTTAACTATTCCAAATTAAACAACAATAAGACACCAAATTAAACTTAGCGGC
ACTCCTGAAGAAAACGAAAGAGTTTATGATTTTGTGGTAGACGTAGATAGTTAATTGGGT
ATGGAAATTATGCCTTTCTTCTCTCAAAAGGTCGTTTTATAGGAAAAGAAAGATTCACAA
AAGCATCCCTTCATTACCTTAAACTAAAAGATTAAAGATTTAGATAAAAAATTTACAGAA
ACATTAGAAAAAATAAAATCACATAAGTTCAAAAGAGATTCGTATTTCGCCTACACCTTA
GATCCATCTCTTTATATAGAAAATACTATCTTACAATAAAATATATACTTATAGATGATG
AAAGAAGATAAATAATGTCCTATCGATGATCCTACTTCCTTGCAATACATGATGGATAAC
GAAGATTTGGTTGAAAGAGAGATTAAAAGATATCTCGATAATTTGGATGGAATTAAGGGA
GAAAGAGAATTTGAACTTTATTAATAAGAAATGCTTAACAACTAGAATACATATGATGCA
ACAAGCAATGCAAACCAATCATAATAACAGCTTTGA


>TTHERM_00925560(gene)
ATGTAAAATTAATAGGTAAATCCAGCAGCTGGCATGAGTGCTCCTTAAAACCCAAATATG
ATGAATGGCTAGTAACGCCCCTTGGGACCTCCCTAGCCCTAAGGACACTTTTAAAGAAAT
TAGATGGCTAATCCTCAAGGACAAGGAGGAATGGGAGGAAATTAATAAGGTGTAATTTAT
GGATAAGGTGGATAATAAGGCCACCCACAATAGCAAATTATGAGTTAATAATAAGGAGTT
TAGCCAAATCAATAATAAAATATTCCATAGTAATAACAGCAGCAATAAGGTTCATAATCG
CACGCAGCATAAGAAAGTTATATTGACCCAAAATAGCTGATTCATTCGATTTATGAAAAG
GGTAATATTGGGTATTCTGAGTGTGATGAAGAATTATTAAAAATAGCCCCAGAATTTGAA
TTACTTAATTAGCTTGTTAAATATGAAGGAATGATTGATAAAATGGTGAAAAGAAAGAGA
TTCGATTTACAGGAATAGTTTGCAAGACCAAATTAAAAGACAAAACAAATATTCAGAATG
TACATTACTAATGACTATACTTTAGTACCTTAGGGACCTCATATAGATAATGATCCCATG
CAAATTGAATAAGAAGAACAATATATATGGAATCTTAAAATATATGGACATTTGCTTTAA
GAAGACAAGGTAAAATTTATAGCAATAATTGGGATTGAATAGGTTTTCTAATGATTCTTT
TTATAACAGACTAACGCATCATATTTGACAACTCCTAAGCAATATTTTTCAAATTTCTTC
TCAAAAATCACTGTAGAATTCAAGGATCCTCTTTTCAGCAGCGAACCCGTTTAAGTAAAA
ATAAATTGAAGAAATGTTAATAAAGTATTAAGTATAATATTTGATGTAGTGGAGAAAGTC
AGATAAGGTAGAGTAGGGAATAATCATTCGCAAATAAAGCAGCAAGGAAACAGTAGTTAC
AATTCATATTCATTTGTATCACAACCCTTTGAAGTTTAGAGTAAATTTAAATAAATAAGG
AATAATAATTTTAAACAATATTTAAATGAATTGGTTAATAGGTTGATCCTAAGCTCGCTT
CAATTATTGGGTTTGAAATTTGCACTAGATCAACTGCTTTGGCTGCTATTTGGGAATATA
TTAAGGTAACTTAACGAAAATAATTAGAACTTTCAATTAATTATTTAATTATCTGCCAAA
TAATTTTCAATTCACTCTCTTTAAAATAGAGCGCGCAATTTGATGAATTATTTAAATATT
TAATCTACTATTTACTTATAACAAAAGCTTAAAAATTTGTAAGACAGTGAAAATAAAAGT
GAGATAAATTGTGATGATGCGATGAGAAGCGTAAAATTGCGATTATGGAATGCAAATTGA
ATGTTTAATTATAAAATTAACTTTAAAATAGGTATTCTTACAAGACAAAATAAACATAGG
ACAAATCACAGCAAAATTGAGATAACTCTTAACTATTCCAAATTAAACAACAATAAGACA
CCAAATTAAGTAACTATTTTAATGAAAATAAATGATTCTTATGATTGTAATTTAATTAGA
CTTAGCGGCACTCCTGAAGAAAACGAAAGAGTTTATGATTTTGTGGTAGACGTAGATAGT
TAATTGGGTATGGAAATTATGCCTTTCTTCTCTCAAAAGGTCGTTTTATAGGAAAAGAAA
GATTCACAAAAGCATCCCTTCATTACCTTAAACTAAAAGATTAAAGATTTAGATAAAAAA
TTTACAGAAACATTAGAAAAAATAAAATCACATAAGTTCAAAAGAGATTCGTATTTCGCC
TACACCTTAGATCCATCTCTTTATATAGAAAATACTATCTTACAATAAAATATATACTTA
TAGGTAATTATTAAATTCTAATAAGAATCATTATTTTAATATATCTATTTCATTTAAAAG
ATGATGAAAGAAGATAAATAATGTCCTATCGATGATCCTACTTCCTTGCAATACATGATG
GATAACGAAGTAAAACACAAATTTTAATTTAAGCAATAAAATAAATTCAATAATTATTTT
CATTTTAGGATTTGGTTGAAAGAGAGATTAAAAGATATCTCGATAATTTGGATGGAATTA
AGGGAGAAAGAGAATTTGAACTTTATTAATAAGAAATGCTTAACAACTAGAATACATATG
ATGCAACAAGCAATGCAAACCAATCATAATAACAGCTTTGA


>TTHERM_00925560(protein)
MQNQQVNPAAGMSAPQNPNMMNGQQRPLGPPQPQGHFQRNQMANPQGQGGMGGNQQGVIY
GQGGQQGHPQQQIMSQQQGVQPNQQQNIPQQQQQQQGSQSHAAQESYIDPKQLIHSIYEK
GNIGYSECDEELLKIAPEFELLNQLVKYEGMIDKMVKRKRFDLQEQFARPNQKTKQIFRM
YITNDYTLVPQGPHIDNDPMQIEQEEQYIWNLKIYGHLLQEDKTNASYLTTPKQYFSNFF
SKITVEFKDPLFSSEPVQWRKSDKVEQGIIIRKQSSKETVVTIHIHLYHNPLKFRVDPKL
ASIIGFEICTRSTALAAIWEYIKLKNLQDSENKSEINCDDAMRSVFLQDKINIGQITAKL
RQLLTIPNQTTIRHQIKLSGTPEENERVYDFVVDVDSQLGMEIMPFFSQKVVLQEKKDSQ
KHPFITLNQKIKDLDKKFTETLEKIKSHKFKRDSYFAYTLDPSLYIENTILQQNIYLQMM
KEDKQCPIDDPTSLQYMMDNEDLVEREIKRYLDNLDGIKGEREFELYQQEMLNNQNTYDA
TSNANQSQQQL