Identifiers and Description

Gene Model Identifier

TTHERM_00925730

Standard Name

SFR2 (Sfi1 Repeat containing protein)

Aliases

PreTt04380 | 165.m00098 | 3747.m00348

Description

SFR2 hypothetical protein; hypothetical protein; predicted to have 4 Sfi1 repeats

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20675.1 9.997093137033517e-262
Description: hypothetical protein (533 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00925730(coding)
ATGAATAACTAAGAGACATTAGCAGATTGCTTTGCTGTATTGCAATTATATGCTGAAAGA
AGGATTAAAAAAAGAAACCAATTAATGCTCTCTAGTTTGTTTAGATATAAATAAATGTTT
CAAAAATTTTATAAGGCCACTCAGTTAAGTTAAAAAATAGACTATGTTCTGCCATATTTT
AGGAGATTTTTGAGAAATATTCATGAAAAAAGGATGAAAATAGTCAAATTTATAATTAAT
AAAGAGAAAGTAGGTTTATAAAAATAGTATTAATCATGGAAGACTTATTTCCTGAAGAAG
AAAAACTAGAGAGAACTATTATAAACTATTTAAGAATATAAAGAAGCCTAAATTATTGAA
AAAGCCTTTAATAACTTAAGAAAAAATATAATATTTAGCTAAGGTTTGAAGAGATTAATA
AAGAACCAAATATACAGAAGATAAGCAGTAGGATTTGCAAGTTTAAAAGAATATCTTAAA
ATTCAAAAATTCAAAAGAGATACTTTAAAGAGTGTCAGAGATTACTTTTAGTAAAATACT
CTTTTAAAGTGCTTTAAATATTGGAATTATGGATGCTCTAAAGCAGATGAAGACATTCAT
AAATATCTCCGTTTAAGAAATTGTTTCTTAAATTGGAGAAATGGTTTAGATAGGAATAAT
GATTTAAACATGAAAAAAATAACTCTTTTTAGAGTTCATTCTCTCTTAAAGTGGAATTTT
ATCAGACTTAAAAAAATAGTTGAATTTGAAAAGCTCAATTCTATGGCAAAAAAGTTTCAT
CTTTTCTAAATTTTTCATGCTTTCTGCATAGTGGTTAGGAAAAATAAGTTTAAATAATAT
AAAAAGAGAAAGGCTCTCCATTACTTTAAAAATTAGCACTCATTTTTTCTAAAGAAGAGG
ATATTCTAGCTTTTCAAGAAAGCCGTCTCAATAAGCCAAGAAGAAAGGTTTAAAGATGAG
GCAGTGAATTCTTATTATGAGAGTAAAGAGAAGGAGAGATTGGCTTTGTAAACATTTTAA
AGGTTAAAATTGAATGTTAAGATTAATAAAGCAGAAAGACACAGAAAAAATAAACTGCAA
AAGAAGTCACTTTAGAGGTGGAGGGAGTTTAGATAAGTTTCTATTGAGAGAAAAAGATTA
ATTGTCTTGAAAATTTTTAACAGAAAAAAAGATCTGATTGAAAAATCTTTCTTTTTCTTA
AAAAAGTTTGTAGAATACAGAAGGGCTAAACTAAAAATGGCTGTTTAATATTATCAAAAG
AGGATGATGAGAACTTCTTTATATAATTGGCTTGGAAATATTGTTAATGACTATCTGCTT
AAACAAGTAGATGCAGACAATTACTACAAATTTAAAATTAAGTTAAGATGTTTCCAACAA
TTAGAAAAGAATAAAAATATTTAACAAAGAAAAAAATTAATTGAAACAAGAATAATTAAC
TTTTAAAATAAACAAGAAGATATCTTGTTATGGAGAAGCTTTTAGAAATTTAAAGGTATG
ATAGTGTCCATTTTACGGCATAAAAAATACAACTATGATTTAGTTAATTCTGTATTTTAT
AATTGGAAATTATTGATAAAGATGAAAAAGATATACTGA


>TTHERM_00925730(gene)
ATGAATAACTAAGAGACATTAGCAGATTGCTTTGCTGTATTGCAATTATATGCTGAAAGA
AGGTAAAACTTTTAAAATGCTTAAATTCAATTGTAATAATTTTGAATTATCAAATAGGAT
TAAAAAAAGAAACCAATTAATGCTCTCTAGTTTGTTTAGATATAAATAAATGTTTCAAAA
ATTTTATAAGGCCACTCAGTTAAGTTAAAAAATAGACTATGTTCTGCCATATTTTAGGAG
ATTTTTGAGAAATATTCATGAAAAAAGGATGAAAATAGTCAAATTTATAATTAATAAAGA
GAAAGTAGGTTTATAAAAGTAAGTAAATAAATGATTTAATTTTTAGAATTTTTGCAATAA
ATAGTATTTTTTAAGATAGTATTAATCATGGAAGACTTATTTCCTGAAGAAGAAAAACTA
GAGAGAACTATTATAAACTATTTAAGAATATAAAGAAGCCTAAATTATTGAAAAAGCCTT
TAATAACTTAAGAAAAAATATAATATTTAGCTAAGGTTTGAAGAGATTAATAAAGAACCA
AATATACAGAAGATAAGCAGTAGGATTTGCAAGTTTAAAAGAATATCTTAAAATTCAAAA
ATTCAAAAGAGATACTTTAAAGAGTGTCAGAGATTACTTTTAGTAAAATACTCTTTTAAA
GTGCTTTAAATATTGGAATTATGGATGCTCTAAAGCAGATGAAGACATTCATAAATATCT
CCGTTTAAGAAATTGTTTCTTAAATTGGAGAAATGGTTTAGATAGGAATAATGATTTAAA
CATGAAAAAAATAACTCTTTTTAGAGTTCATTCTCTCTTAAAGTGGAATTTTATCAGACT
TAAAAAAATAGTTGAATTTGAAAAGCTCAATTCTATGGCAAAAAAGTTTCATCTTTTCTA
AATTTTTCATGCTTTCTGCATAGTGGTTAGGAAAAATAAGTTTAAATAATATAAAAAGAG
AAAGGCTCTCCATTACTTTAAAAATTAGCACTCATTTTTTCTAAAGAAGAGGATATTCTA
GCTTTTCAAGAAAGCCGTCTCAATAAGCCAAGAAGAAAGGTTTAAAGATGAGGCAGGTAA
ATATATAGATTATTTTTTTTATTATCTACTTTTATATTCCTTCCAAATAATTTTGTCGAA
AATTAAAGCTTTATGAGGCTTTAGGAAGCAATTTTTGATAGAATTATTATTATTTTTGAC
ATTTTTTAAATATTATTCATTAAAAAGTGAATTCTTATTATGAGAGTAAAGAGAAGGAGA
GATTGGCTTTGTAAACATTTTAAAGGTTAAAATTGAATGTTAAGATTAATAAAGCAGAAA
GACACAGAAAAAATAAACTGCAAAAGAAGTCACTTTAGAGGTGGAGGGAGTTTAGATAAG
TTTCTATTGAGAGAAAAAGATTAATTGTCTTGAAAATTTTTAACAGAAAAAAAGATCTGA
TTGAAAAATCTTTCTTTTTCTTAAAAAAGTATGCAATTAATTAATTGATTGAATAATTTA
AAAAAGCTTTTAATTTGCAAAAATAAAAAAGGTTTGTAGAATACAGAAGGGCTAAACTAA
AAATGGCTGTTTAATATTATCAAAAGAGGATGATGAGAACTTCTTTATATAATTGGCTTG
GAAATATTGTTAATGACTATCTGCTTAAACAAGTAGATGCAGACAATTACTACAAATTTA
AAATTAAGTTAAGATGTTTCCAACAATTAGAAAAGAATAAAAATATTTAACAAAGAAAAA
AATTAATTGAAACAAGAATAATTAACTTTTAAAATAAACAAGAAGATATCTTGTTATGGA
GAAGCTTTTAGAAATTTAAAGGTATGATAGTGTCCATTTTACGGCATAAAAAATACAACT
ATGATTTAGTTAATTCTGTATTTTATAATTGGAAATTATTGATAAAGATGAAAAAGATAT
ACTGA


>TTHERM_00925730(protein)
MNNQETLADCFAVLQLYAERRIKKRNQLMLSSLFRYKQMFQKFYKATQLSQKIDYVLPYF
RRFLRNIHEKRMKIVKFIINKEKVGLQKQYQSWKTYFLKKKNQRELLQTIQEYKEAQIIE
KAFNNLRKNIIFSQGLKRLIKNQIYRRQAVGFASLKEYLKIQKFKRDTLKSVRDYFQQNT
LLKCFKYWNYGCSKADEDIHKYLRLRNCFLNWRNGLDRNNDLNMKKITLFRVHSLLKWNF
IRLKKIVEFEKLNSMAKKFHLFQIFHAFCIVVRKNKFKQYKKRKALHYFKNQHSFFLKKR
IFQLFKKAVSISQEERFKDEAVNSYYESKEKERLALQTFQRLKLNVKINKAERHRKNKLQ
KKSLQRWREFRQVSIERKRLIVLKIFNRKKDLIEKSFFFLKKFVEYRRAKLKMAVQYYQK
RMMRTSLYNWLGNIVNDYLLKQVDADNYYKFKIKLRCFQQLEKNKNIQQRKKLIETRIIN
FQNKQEDILLWRSFQKFKGMIVSILRHKKYNYDLVNSVFYNWKLLIKMKKIY