Identifiers and Description

Gene Model Identifier

TTHERM_00925850

Standard Name

CTH49 (CaTHepsin 49)

Aliases

PreTt04392 | 165.m00110 | 3747.m00360

Description

CTH49 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_07844.1 1.999576471039937e-58
Description: hypothetical protein (343 aa)
DictyBase DDB_G0290957 1.9991939848149086e-44
Description: cprA on chromosome: 5 position 4812963 to 4814596
Oxytricha Contig19008.0.g54 4.997755005759707e-41
Description: Papain family cysteine protease
WormBase WBGene00019986 2.0005131442217614e-40
Description: status:Confirmed UniProt:Q23030 protein_id:CCD69414.1
Stentor Coeruleus SteCoe_25185 2.1151310375910805e-19
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00925850(coding)
ATGTGCTGTTCATAATAAAGTGTTATTATTATTTTTATTTTAATATTGATTGTTAATGGA
CAATCAAATTTTGACAAAAATACATTTAGTTAAAAACATTAGCATCACTAAAAATTTGAA
CAATTCAAAAAAAGTTTTTCTAAGGCTTATGAAAGTGAAGAAGTTCAGTAATTCAGATTT
GCTACTTTTGTTGAAAATCTTAATGAAATTGACAGGCTAAATGCAGAAGTAACCACTGCT
TAATTTGACATTTCTTTTTTTAGTGATTATACAAAAGAAGAATTCTTGAATTTGTTCACT
GGAGCACATAAACTTGCTATCTCTGATTAAGATTAATCATAAAATAATGATAACTAAAAC
AATTAAAATACTTAATCAAATAATTAAACATCATAAGACAATTAAAACGTAAATTAATAA
AAATAAACAAAGGCTTCTAATCCTACTACTTGGGATATTAGAGTAAATGGTCCTGGTAAA
TTATAAGAAATCAAAAATTAAGGCGGATGTGGAAGTTGTTGGGCATTTTCTACTTCTGTT
GCAGTAGAGAGTTATTATTCAGCTAAAAAAAATATTACAGTGAGTCTCTCTGAATAACAG
CAAGTAGATTGCGTTTATGATCGCGATGGATGTTAGGGCGGATGGTTTACTGACTCTTTT
GATTATGCTAAACTCACTGGACTTATGACAGAATCTGCTTATCCTTATTAAGGAGCATAT
GGATCTTCATGCTAATTCTCTAATAAAACATCTATATATAAAATAAAAAGTTATTAAAAT
CTCCAAAAGAACAATTCTGTAATACAAAAAGCTGTAATGTAGAATGGTGCTGTTTCGGTA
GCAGTAGACGGTACTTATTGGGCCCACTATAAATCTGGTATTTTTACTTAAAAATAAAAA
CCTTAATTAAACCATGCTGTTGCTATTGTAGGATGGGGAAGTGGCTATTGGTTGCTTAGA
AACAGCTGGGGTACTTCATGGGGAGATTAAGGTTACATAAAAGTATCTAGCACAGGTAAT
GGTGGAATATTTACTTAATATGCATATTAACCAAATTGA


>TTHERM_00925850(gene)
ATGTGCTGTTCATAATAAAGTGTTATTATTATTTTTATTTTAATATTGATTGTTAATGGA
CAATCAAATTTTGACAAAAATACATTTAGTTAAAAACATTAGCATCACTAAAAATTTGAA
CAATTCAAAAAAAGTTTTTCTAAGGCTTATGAAAGTGAAGAAGTTCAGTAATTCAGATTT
GCTACTTTTGTTGAAAATCTTAATGAAATTGACAGGCTAAATGCAGAAGTAACCACTGCT
TAATTTGACATTTCTTTTTTTAGTGATTATACAAAAGAAGAATTCTTGAATTTGTTCACT
GGAGCACATAAACTTGCTATCTCTGATTAAGATTAATCATAAAATAATGATAACTAAAAC
AATTAAAATACTTAATCAAATAATTAAACATCATAAGACAATTAAAACGTAAATTAATAA
AAATAAACAAAGGCTTCTAATCCTACTACTTGGGATATTAGAGTAAATGGTCCTGGTAAA
TTATAAGAAATCAAAAATTAAGGCGGATGTGGAAGTTGTTGGGCATTTTCTACTTCTGTT
GCAGTAGAGAGTTATTATTCAGCTAAAAAAAATATTACAGTGAGTCTCTCTGAATAACAG
CAAGTAGATTGCGTTTATGATCGCGATGGATGTTAGGGCGGATGGTTTACTGACTCTTTT
GATTATGCTAAACTCACTGGACTTATGACAGAATCTGCTTATCCTTATTAAGGAGCATAT
GGATCTTCATGCTAATTCTCTAATAAAACATCTATATATAAAATAAAAAGTTATTAAAAT
CTCCAAAAGAACAATTCTGTAATACAAAAAGCTGTAATGTAGAATGGTGCTGTTTCGGTA
GCAGTAGACGGTACTTATTGGGCCCACTATAAATCTGGTATTTTTACTTAAAAATAAAAA
CCTTAATTAAACCATGCTGTTGCTATTGTAGGATGGGGAAGTGGCTATTGGTTGCTTAGA
AACAGCTGGGGTACTTCATGGGGAGATTAAGGTTACATAAAAGTATCTAGCACAGGTAAT
GGTGGAATATTTACTTAATATGCATATTAACCAAATTGA


>TTHERM_00925850(protein)
MCCSQQSVIIIFILILIVNGQSNFDKNTFSQKHQHHQKFEQFKKSFSKAYESEEVQQFRF
ATFVENLNEIDRLNAEVTTAQFDISFFSDYTKEEFLNLFTGAHKLAISDQDQSQNNDNQN
NQNTQSNNQTSQDNQNVNQQKQTKASNPTTWDIRVNGPGKLQEIKNQGGCGSCWAFSTSV
AVESYYSAKKNITVSLSEQQQVDCVYDRDGCQGGWFTDSFDYAKLTGLMTESAYPYQGAY
GSSCQFSNKTSIYKIKSYQNLQKNNSVIQKAVMQNGAVSVAVDGTYWAHYKSGIFTQKQK
PQLNHAVAIVGWGSGYWLLRNSWGTSWGDQGYIKVSSTGNGGIFTQYAYQPN