Identifiers and Description

Gene Model Identifier

TTHERM_00925870

Standard Name

CTH56 (CaTHepsin 56)

Aliases

PreTt04394 | 165.m00112 | 3747.m00362

Description

CTH56 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_07844.1 2.9997246065828143e-59
Description: hypothetical protein (343 aa)
Oxytricha Contig1254.0.g80 6.997125142158947e-47
Description: Papain family cysteine protease
DictyBase DDB_G0291191 5.999907735769095e-44
Description: DDB_G0291191 on chromosome: 5 position 5086072 to 5087429
WormBase WBGene00007055 9.99648502569394e-38
Description: locus:tag-196 status:Confirmed UniProt:O16454 protein_id:CCD64084.1
Stentor Coeruleus SteCoe_2628 2.8625185805493937e-20
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00925870(coding)
ATGTGGAATAAATAAAAAAGTGTAGTTATTATTTTTATTTTGATATTGCTTGTTACAGGG
CAATAGAATGATAACTAAAATAACTTTAATAAAAAACATTAACACCACAAAAAGTTTAAA
GTCTTCAAAAACACTTATTCTAAGGTTTATGAAAGCAAAGAAGTTGAGTAATTCAGATTT
GCTACTTTTGTTGAAAATCTTAAAGAAATTGATAGGCTAAATGCAGAAGTAACCACTGCT
TAATTTGACATTTCTTTTTTTAGTGATTTCACCAAAGAAGAGTTCTTGAATTTGTTCACT
GGAGCACATAAACCTGCTATGTCTGACTAAGATTAATTATAAAACAATAATAACTCAAAT
AATTAAAATGATTAATCAAATAATTAAAAATCATCAGACAAATCAAACTAAAATGAATAA
AAATAAATAGAAGAATCTATTCCTAGTTCTTGGGATATAAGAACAGATGGTCCTGGATTA
TTATAACCAGTCGAAAATCAAGGCCAATGTGGAAGTTGTTGGGCATTTTCTACTTCTGGT
GCAGTAGAGAGCTATTATTCAGCTAAAAAAAATATTACATTGAATCTCTCAAAATAGCAG
TTAGTAGATTGTGTTTATGATCATGGTGGATGTGATGGCGGGTGGTTTAATGATGCTTTT
AAATATATACAAAGCGTTGGTATTGTTTTAAATGCTACTTATTATCCTTACATAAATAAA
GATTAAACTGAACCGTGCTAATTATCTAAATTACCTAAGGGAACATCTTTTTATCAAATA
TAAGGTTATAAAAAATTAGAAAATGATACATCTGTAATAAAATAAGCTATAATGCAGAAC
GGTGCTCTTTCGATAGCAGTTGATGCTACTTATTGGGCAAACTATAAATCTGGTATTTTT
ACTTAAAAAGAAAAACCTTAAATAAATCATGCTGTTACTCTTATAGGATGGGGAAGCGAT
TACTGGCTGCTTAGAAATAGCTGGGGTTCTTCATGGGGTGAATAAGGTTACATCAAAGTT
ACTAACACTGGCTATAGTGGAATATTTCCTTAATATACATATTCACCAATTAAATGA


>TTHERM_00925870(gene)
ATGTGGAATAAATAAAAAAGTGTAGTTATTATTTTTATTTTGATATTGCTTGTTACAGGG
CAATAGAATGATAACTAAAATAACTTTAATAAAAAACATTAACACCACAAAAAGTTTAAA
GTCTTCAAAAACACTTATTCTAAGGTTTATGAAAGCAAAGAAGTTGAGTAATTCAGATTT
GCTACTTTTGTTGAAAATCTTAAAGAAATTGATAGGCTAAATGCAGAAGTAACCACTGCT
TAATTTGACATTTCTTTTTTTAGTGATTTCACCAAAGAAGAGTTCTTGAATTTGTTCACT
GGAGCACATAAACCTGCTATGTCTGACTAAGATTAATTATAAAACAATAATAACTCAAAT
AATTAAAATGATTAATCAAATAATTAAAAATCATCAGACAAATCAAACTAAAATGAATAA
AAATAAATAGAAGAATCTATTCCTAGTTCTTGGGATATAAGAACAGATGGTCCTGGATTA
TTATAACCAGTCGAAAATCAAGGCCAATGTGGAAGTTGTTGGGCATTTTCTACTTCTGGT
GCAGTAGAGAGCTATTATTCAGCTAAAAAAAATATTACATTGAATCTCTCAAAATAGCAG
TTAGTAGATTGTGTTTATGATCATGGTGGATGTGATGGCGGGTGGTTTAATGATGCTTTT
AAATATATACAAAGCGTTGGTATTGTTTTAAATGCTACTTATTATCCTTACATAAATAAA
GATTAAACTGAACCGTGCTAATTATCTAAATTACCTAAGGGAACATCTTTTTATCAAATA
TAAGGTTATAAAAAATTAGAAAATGATACATCTGTAATAAAATAAGCTATAATGCAGAAC
GGTGCTCTTTCGATAGCAGTTGATGCTACTTATTGGGCAAACTATAAATCTGGTATTTTT
ACTTAAAAAGAAAAACCTTAAATAAATCATGCTGTTACTCTTATAGGATGGGGAAGCGAT
TACTGGCTGCTTAGAAATAGCTGGGGTTCTTCATGGGGTGAATAAGGTTACATCAAAGTT
ACTAACACTGGCTATAGTGGAATATTTCCTTAATATACATATTCACCAATTAAATGA


>TTHERM_00925870(protein)
MWNKQKSVVIIFILILLVTGQQNDNQNNFNKKHQHHKKFKVFKNTYSKVYESKEVEQFRF
ATFVENLKEIDRLNAEVTTAQFDISFFSDFTKEEFLNLFTGAHKPAMSDQDQLQNNNNSN
NQNDQSNNQKSSDKSNQNEQKQIEESIPSSWDIRTDGPGLLQPVENQGQCGSCWAFSTSG
AVESYYSAKKNITLNLSKQQLVDCVYDHGGCDGGWFNDAFKYIQSVGIVLNATYYPYINK
DQTEPCQLSKLPKGTSFYQIQGYKKLENDTSVIKQAIMQNGALSIAVDATYWANYKSGIF
TQKEKPQINHAVTLIGWGSDYWLLRNSWGSSWGEQGYIKVTNTGYSGIFPQYTYSPIK