Identifiers and Description

Gene Model Identifier

TTHERM_00933270

Standard Name

CYC22 (CYClin 22)

Aliases

PreTt17926 | 168.m00094 | 3745.m00039

Description

CYC22 amine-terminal domain cyclin; Cyclin, N-terminal domain containing protein; Cyclin

Genome Browser (Macronucleus)

Full Screen View

No Genome Browser Data Present

Genome Browser (Micronucleus)

Full Screen View

No Genome Browser Data Present

External Links

• Uniprot
• Alphafold

Gene Ontology Annotations

Cellular Component

• aleurone grain membrane (IEA) | GO:0032578
• alpha6-beta1 integrin-CD151 complex (IEA) | GO:0071059
• cellulosome (IEA) | GO:0043263
• chloroplast ribosome (IEA) | GO:0043253
• clathrin-sculpted glutamate transport vesicle lumen (IEA) | GO:0060204
• clathrin-sculpted glutamate transport vesicle membrane (IEA) | GO:0060203
• contractile vacuole (IEA) | GO:0000331
• CURI complex (IEA) | GO:0032545
• Dbf4-dependent protein kinase complex (IEA) | GO:0031431
• endoplasmic reticulum-Golgi intermediate compartment (IEA) | GO:0005793
• external side of fungal-type cell wall (IEA) | GO:0070263
• ionotropic glutamate receptor complex (IEA) | GO:0008328
• multivesicular body (IEA) | GO:0005771
• NAGS/NAGK complex (IEA) | GO:0106098
• Nrd1 complex (IEA) | GO:0035649
• obsolete ectoplasm (IEA) | GO:0043265
• obsolete plasma membrane part of cell junction (IEA) | GO:0061466
• parallel fiber (IEA) | GO:1990032
• subrhabdomeral cisterna (IEA) | GO:0016029
• vacuolar HOPS complex (IEA) | GO:1902500
• vacuolar membrane (IEA) | GO:0005774
• VEGF-A complex (IEA) | GO:1990150

Molecular Function

• (1->3),(1->4)-beta-glucan binding (IEA) | GO:2001077
• (3R)-3-isopropenyl-6-oxoheptanoate:CoA ligase (AMP-forming) activity (IEA) | GO:0052688
• 11-deoxycorticosterone binding (IEA) | GO:1903878
• 17alpha-hydroxyprogesterone binding (IEA) | GO:1903880
• 2-octaprenyl-6-methoxyphenol hydroxylase activity (IEA) | GO:0008681
• 3-demethoxyubiquinol 3-hydroxylase activity (IEA) | GO:0008682
• 3-hydroxybutyrate dehydrogenase activity (IEA) | GO:0003858
• 3-hydroxybutyryl-CoA dehydrogenase activity (IEA) | GO:0008691
• 4-chloro-allylglycine synthase activity (IEA) | GO:0062146
• 8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase activity (IEA) | GO:0008413
• ABC-type maltose transporter activity (IEA) | GO:0015423
• ABC-type oligosaccharide transporter activity (IEA) | GO:0015422
• acylglycerone-phosphate reductase (NADP+) activity (IEA) | GO:0000140
• alpha-D-glucan binding (IEA) | GO:2001083
• amino acid transmembrane transporter activity (IEA) | GO:0015171
• aminotriazole transporter activity (IEA) | GO:0015241
• aromatase activity (IEA) | GO:0008402
• arsenate reductase (glutaredoxin) activity (IEA) | GO:0008794
• axon guidance receptor activity (IEA) | GO:0008046
• benomyl transporter activity (IEA) | GO:0015242
• carboxylic ester hydrolase activity (IEA) | GO:0052689
• carboxymethylenebutenolidase activity (IEA) | GO:0008806
• carboxyvinyl-carboxyphosphonate phosphorylmutase activity (IEA) | GO:0008807
• Cys-tRNA(Pro) hydrolase activity (IEA) | GO:0043907
• dolichyl pyrophosphate Glc2Man9GlcNAc2 alpha-1,2-glucosyltransferase activity (IEA) | GO:0106073
• ferredoxin-NAD(P) reductase activity (IEA) | GO:0008937
• ferric enterobactin:proton symporter activity (IEA) | GO:0015345
• ferric triacetylfusarinine C:proton symporter activity (IEA) | GO:0015346
• FMN reductase (NADH) activity (IEA) | GO:0052874
• L-aspartate oxidase activity (IEA) | GO:0008734
• L-gamma-glutamyl-L-propargylglycine hydroxylase activity (IEA) | GO:0062148
• L-propargylglycine synthase activity (IEA) | GO:0062144
• lactaldehyde reductase activity (IEA) | GO:0008912
• lipopolysaccharide heptosyltransferase activity (IEA) | GO:0008920
• lipopolysaccharide-1,6-galactosyltransferase activity (IEA) | GO:0008921
• long-chain fatty acid [acyl-carrier-protein] ligase activity (IEA) | GO:0008922
• mannitol-1-phosphate 5-dehydrogenase activity (IEA) | GO:0008926
• mercury ion transmembrane transporter activity (IEA) | GO:0015097
• metarhodopsin binding (IEA) | GO:0016030
• methane monooxygenase [NAD(P)H] activity (IEA) | GO:0015049
• mitochondrial RNA polymerase binding promoter specificity activity (IEA) | GO:0000998
• myoinhibitory hormone activity (IEA) | GO:0016085
• O-phospho-L-serine:2-oxoglutarate aminotransferase activity (IEA) | GO:0004648
• obsolete amiloride transmembrane transporter activity (IEA) | GO:0015240
• obsolete aspartic-type signal peptidase activity (IEA) | GO:0009049
• obsolete cation:cation antiporter activity (IEA) | GO:0015491
• obsolete cobalt, zinc uptake permease activity (IEA) | GO:0015339
• obsolete D-lysine oxidase activity (IEA) | GO:0043912
• obsolete DNA topoisomerase IV activity (IEA) | GO:0008724
• obsolete perillic acid-CoA ligase (ADP-forming) activity (IEA) | GO:0052685
• obsolete proprotein convertase 2 activator activity (IEA) | GO:0016484
• obsolete sodium-translocating F-type ATPase activity (IEA) | GO:0016468
• obsolete sodium-transporting two-sector ATPase activity (IEA) | GO:0015443
• obsolete tocopherol omega-hydroxylase activity (IEA) | GO:0052870
• obsolete type II protein secretor activity (IEA) | GO:0015447
• obsolete X-His dipeptidase activity (IEA) | GO:0008769
• obsolete zinc, cadmium uptake permease activity (IEA) | GO:0015340
• obsolete zinc, iron permease activity (IEA) | GO:0015342
• oligoxyloglucan reducing-end-specific cellobiohydrolase activity (IEA) | GO:0033945
• oxalyl-CoA decarboxylase activity (IEA) | GO:0008949
• palmitoleoyl [acyl-carrier-protein]-dependent acyltransferase activity (IEA) | GO:0008951
• parathyroid hormone receptor binding (IEA) | GO:0031856
• penicillin amidase activity (IEA) | GO:0008953
• phosphatidylcholine:cardiolipin O-linoleoyltransferase activity (IEA) | GO:0032577
• phosphatidylserine decarboxylase activity (IEA) | GO:0004609
• poly(ADP-ribose) glycohydrolase activity (IEA) | GO:0004649
• polyamine transmembrane transporter activity (IEA) | GO:0015203
• pyrimidine nucleotide-sugar transmembrane transporter activity (IEA) | GO:0015165
• rhamnulose-1-phosphate aldolase activity (IEA) | GO:0008994
• Ser(Gly)-tRNA(Ala) hydrolase activity (IEA) | GO:0043908
• siderophore uptake transmembrane transporter activity (IEA) | GO:0015344
• siderophore-iron transmembrane transporter activity (IEA) | GO:0015343
• silver ion transmembrane transporter activity (IEA) | GO:0015080
• sphingomyelin phosphodiesterase activity (IEA) | GO:0004767
• sterol 14-demethylase activity (IEA) | GO:0008398
• Swi5-Sfr1 complex binding (IEA) | GO:1905334
• thrombospondin receptor activity (IEA) | GO:0070053
• TSC1-TSC2 complex binding (IEA) | GO:0062078
• type 4 neuropeptide Y receptor binding (IEA) | GO:0031844
• UDP-galactopyranose mutase activity (IEA) | GO:0008767
• zinc efflux active transmembrane transporter activity (IEA) | GO:0015341

Biological Process

• 3-keto-sphinganine metabolic process (IEA) | GO:0006666
• absorption of visible light (IEA) | GO:0016038
• aldosterone biosynthetic process (IEA) | GO:0032342
• aromatic amino acid family biosynthetic process (IEA) | GO:0009073
• aromatic amino acid metabolic process (IEA) | GO:0009072
• basement membrane organization (IEA) | GO:0071711
• brassinosteroid homeostasis (IEA) | GO:0010268
• bud dilation involved in lung branching (IEA) | GO:0060503
• cell surface receptor signaling pathway involved in heart development (IEA) | GO:0061311
• cell wall modification involved in fruit ripening (IEA) | GO:0009829
• cellotriose transport (IEA) | GO:2001096
• cellular response to homocysteine (IEA) | GO:1905375
• ceramide phosphoethanolamine catabolic process (IEA) | GO:1905372
• ceramide phosphoethanolamine metabolic process (IEA) | GO:1905371
• coenzyme A biosynthetic process (IEA) | GO:0015937
• cold-induced thermogenesis (IEA) | GO:0106106
• cytoplasmic translational initiation (IEA) | GO:0002183
• D-tagatose 6-phosphate catabolic process (IEA) | GO:2001059
• DN2 thymocyte differentiation (IEA) | GO:1904155
• DNA replication preinitiation complex assembly (IEA) | GO:0071163
• dorsal closure, leading edge cell fate commitment (IEA) | GO:0035029
• embryonic root morphogenesis (IEA) | GO:0010086
• endoplasmic reticulum to cytosol transport (IEA) | GO:1903513
• Entner-Doudoroff pathway through gluconate to D-glyceraldehyde-3-phosphate (IEA) | GO:0061681
• eosinophil activation involved in immune response (IEA) | GO:0002278
• epithelial cell maturation (IEA) | GO:0002070
• epithelium development (IEA) | GO:0060429
• Factor XII activation (IEA) | GO:0002542
• female courtship behavior (IEA) | GO:0008050
• flower phyllotactic patterning (IEA) | GO:0060773
• galactose to glucose-1-phosphate metabolic process (IEA) | GO:0061612
• gamma-tubulin complex assembly (IEA) | GO:1902481
• glycolytic process from glycerol (IEA) | GO:0061613
• glycolytic process through fructose-6-phosphate (IEA) | GO:0061615
• glycopeptide catabolic process (IEA) | GO:0009050
• hair cycle process (IEA) | GO:0022405
• haltere disc morphogenesis (IEA) | GO:0007481
• heme A biosynthetic process (IEA) | GO:0006784
• heme biosynthetic process (IEA) | GO:0006783
• histoblast morphogenesis (IEA) | GO:0007488
• homogentisate metabolic process (IEA) | GO:1901999
• imaginal disc-derived female genitalia development (IEA) | GO:0007486
• immune response in urogenital tract (IEA) | GO:0002422
• immunoglobulin heavy chain V-D-J recombination (IEA) | GO:0071707
• induction of apoptosis by extracellular signals (IEA) | GO:0008624
• inferior colliculus development (IEA) | GO:0061379
• interleukin-12-mediated signaling pathway (IEA) | GO:0035722
• interleukin-15-mediated signaling pathway (IEA) | GO:0035723
• internal genitalia morphogenesis (IEA) | GO:0035260
• intraciliary retrograde transport (IEA) | GO:0035721
• L-alanine catabolic process (IEA) | GO:0042853
• L-beta-ethynylserine biosynthetic process (IEA) | GO:0062142
• L-phenylalanine biosynthetic process (IEA) | GO:0009094
• laminaritriose transport (IEA) | GO:2001097
• leaf phyllotactic patterning (IEA) | GO:0060772
• lipid homeostasis (IEA) | GO:0055088
• lung connective tissue development (IEA) | GO:0060427
• lung epithelium development (IEA) | GO:0060428
• lung pattern specification process (IEA) | GO:0060432
• lung saccule development (IEA) | GO:0060430
• maltoheptaose catabolic process (IEA) | GO:2001123
• maltoheptaose metabolic process (IEA) | GO:2001122
• maltohexaose transport (IEA) | GO:2001103
• memory T cell activation (IEA) | GO:0035709
• mesonephric duct formation (IEA) | GO:0072181
• metanephric nephron tubule formation (IEA) | GO:0072289
• mitochondrial membrane organization (IEA) | GO:0007006
• mitotic telophase (IEA) | GO:0000093
• N,N'-diacetylchitobiose import (IEA) | GO:1902815
• negative regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process (IEA) | GO:1902647
• negative regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902642
• negative regulation of antigen processing and presentation of lipid antigen via MHC class Ib (IEA) | GO:0002599
• negative regulation of cellular glucuronidation (IEA) | GO:2001030
• negative regulation of chemokine (C-C motif) ligand 2 secretion (IEA) | GO:1904208
• negative regulation of chromosome organization (IEA) | GO:2001251
• negative regulation of complement-dependent cytotoxicity (IEA) | GO:1903660
• negative regulation of double-strand break repair via nonhomologous end joining (IEA) | GO:2001033
• negative regulation of endothelin production (IEA) | GO:1904471
• negative regulation of epithelial cell-cell adhesion involved in epithelium migration (IEA) | GO:1903682
• negative regulation of immune effector process (IEA) | GO:0002698
• negative regulation of intrinsic apoptotic signaling pathway (IEA) | GO:2001243
• negative regulation of L-glutamine biosynthetic process (IEA) | GO:0062133
• negative regulation of macrophage derived foam cell differentiation (IEA) | GO:0010745
• negative regulation of mediator complex assembly (IEA) | GO:2001177
• negative regulation of metanephric nephron tubule epithelial cell differentiation (IEA) | GO:0072308
• negative regulation of mRNA binding (IEA) | GO:1904572
• negative regulation of nephron tubule epithelial cell differentiation (IEA) | GO:0072183
• negative regulation of oogenesis (IEA) | GO:1905880
• negative regulation of PERK-mediated unfolded protein response (IEA) | GO:1903898
• negative regulation of phosphatidylcholine biosynthetic process (IEA) | GO:2001246
• negative regulation of phytoalexin metabolic process (IEA) | GO:0052321
• negative regulation of postsynaptic membrane organization (IEA) | GO:1901627
• negative regulation of response to drug (IEA) | GO:2001024
• negative regulation of SCF-dependent proteasomal ubiquitin-dependent catabolic process (IEA) | GO:0062026
• negative regulation of sprouting angiogenesis (IEA) | GO:1903671
• negative regulation of vasculogenesis (IEA) | GO:2001213
• nephric duct development (IEA) | GO:0072176
• nephron epithelium morphogenesis (IEA) | GO:0072088
• neural plate formation (IEA) | GO:0021990
• neural plate thickening (IEA) | GO:0021991
• neutral lipid metabolic process (IEA) | GO:0006638
• nitrate transmembrane transport (IEA) | GO:0015706
• Notch signaling pathway involved in negative regulation of venous endothelial cell fate commitment (IEA) | GO:2000796
• nucleoside monophosphate biosynthetic process (IEA) | GO:0009124
• obsolete age dependent accumulation of genetic damage (IEA) | GO:0007570
• obsolete aging (IEA) | GO:0007568
• obsolete auxin mediated signaling pathway involved in phyllotactic patterning (IEA) | GO:0060774
• obsolete cellular response to tunicamycin (IEA) | GO:1904577
• obsolete extracellular carbohydrate transport (IEA) | GO:0006859
• obsolete fertilization, exchange of chromosomal proteins (IEA) | GO:0035042
• obsolete induction by organism of defense-related symbiont reactive oxygen species production (IEA) | GO:0052401
• obsolete invadopodium disassembly (IEA) | GO:1905878
• obsolete MAPK cascade involved in ascospore formation (IEA) | GO:1903695
• obsolete mRNA endonucleolytic cleavage involved in unfolded protein response (IEA) | GO:0070055
• obsolete negative regulation of adhesion of symbiont to host epithelial cell (IEA) | GO:1905227
• obsolete negative regulation of cytochrome-c oxidase activity (IEA) | GO:1905376
• obsolete negative regulation of response to extracellular stimulus (IEA) | GO:0032105
• obsolete positive regulation by organism of defense-related symbiont reactive oxygen species production (IEA) | GO:0052349
• obsolete positive regulation of adhesion of symbiont to host epithelial cell (IEA) | GO:1905228
• obsolete positive regulation of advanced glycation end-product receptor activity (IEA) | GO:1904605
• obsolete positive regulation of establishment of turgor in appressorium (IEA) | GO:0075041
• obsolete positive regulation of G2 phase of mitotic cell cycle (IEA) | GO:2001221
• obsolete positive regulation of metalloendopeptidase activity involved in amyloid precursor protein catabolic process (IEA) | GO:1902964
• obsolete positive regulation of response to DNA damage stimulus (IEA) | GO:2001022
• obsolete positive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response (IEA) | GO:0006990
• obsolete prothoracic morphogenesis (IEA) | GO:0007471
• obsolete regulation of 1-deoxy-D-xylulose-5-phosphate synthase activity (IEA) | GO:1902395
• obsolete regulation of cellular ketone metabolic process by regulation of transcription from RNA polymerase II promoter (IEA) | GO:0072364
• obsolete regulation of glucose-6-phosphatase activity (IEA) | GO:0032114
• obsolete regulation of histone H3-K27 methylation (IEA) | GO:0061085
• obsolete regulation of histone H3-K79 methylation (IEA) | GO:2001160
• obsolete regulation of nucleic acid-templated transcription (IEA) | GO:1903506
• obsolete regulation of transcription from RNA polymerase II promoter involved in lung bud formation (IEA) | GO:0060500
• obsolete reproduction (IEA) | GO:0000003
• obsolete response to long exposure to lithium ion (IEA) | GO:0043460
• obsolete sodium/potassium transport (IEA) | GO:0006815
• ommochrome biosynthetic process (IEA) | GO:0006727
• osteoblast development (IEA) | GO:0002076
• P granule disassembly (IEA) | GO:1903864
• peripheral tolerance induction (IEA) | GO:0002465
• phagocytosis (IEA) | GO:0006909
• phyllotactic patterning (IEA) | GO:0060771
• plant-type cell wall modification (IEA) | GO:0009827
• positive regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902643
• positive regulation of ammonia assimilation cycle (IEA) | GO:2001250
• positive regulation of antifungal innate immune response (IEA) | GO:1905036
• positive regulation of antigen processing and presentation of peptide antigen via MHC class Ib (IEA) | GO:0002597
• positive regulation of cell-cell adhesion (IEA) | GO:0022409
• positive regulation of defense response to bacterium, incompatible interaction (IEA) | GO:1902479
• positive regulation of dendrite extension (IEA) | GO:1903861
• positive regulation of double-strand break repair via nonhomologous end joining (IEA) | GO:2001034
• positive regulation of epithelial cell proliferation involved in lung bud dilation (IEA) | GO:0060504
• positive regulation of epithelial cell proliferation involved in lung morphogenesis (IEA) | GO:0060501
• positive regulation of establishment of RNA localization to telomere (IEA) | GO:1904912
• positive regulation of flavonoid biosynthetic process (IEA) | GO:0009963
• positive regulation of forebrain neuron differentiation (IEA) | GO:2000979
• positive regulation of intestinal epithelial cell development (IEA) | GO:1905300
• positive regulation of macrophage derived foam cell differentiation (IEA) | GO:0010744
• positive regulation of oxidative phosphorylation (IEA) | GO:1903862
• positive regulation of peroxisome proliferator activated receptor signaling pathway (IEA) | GO:0035360
• positive regulation of phospholipid translocation (IEA) | GO:0061092
• positive regulation of response to water deprivation (IEA) | GO:1902584
• positive regulation of SCF-dependent proteasomal ubiquitin-dependent catabolic process (IEA) | GO:0062027
• positive regulation of serine C-palmitoyltransferase activity (IEA) | GO:1904222
• positive regulation of skeletal muscle hypertrophy (IEA) | GO:1904206
• positive regulation of vein smooth muscle contraction (IEA) | GO:0062087
• positive regulation of wound healing, spreading of epidermal cells (IEA) | GO:1903691
• primary lung bud formation (IEA) | GO:0060431
• priming of cellular response to stress (IEA) | GO:0080136
• primitive palate development (IEA) | GO:0062010
• pronephric glomerulus morphogenesis (IEA) | GO:0035775
• pronuclear fusion (IEA) | GO:0007344
• propan-2-ol biosynthetic process (IEA) | GO:1902640
• protein K27-linked deubiquitination (IEA) | GO:1990167
• protein localization to old growing cell tip (IEA) | GO:1903858
• protein processing (IEA) | GO:0016485
• prothoracic disc morphogenesis (IEA) | GO:0007470
• purine nucleoside monophosphate catabolic process (IEA) | GO:0009128
• purine ribonucleoside triphosphate metabolic process (IEA) | GO:0009205
• pyrimidine deoxyribonucleoside triphosphate catabolic process (IEA) | GO:0009213
• pyrimidine nucleotide biosynthetic process (IEA) | GO:0006221
• quercetin metabolic process (IEA) | GO:1901732
• regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process (IEA) | GO:1902646
• regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902641
• regulation of antigen processing and presentation of lipid antigen via MHC class Ib (IEA) | GO:0002598
• regulation of C-C chemokine binding (IEA) | GO:2001263
• regulation of cellular glucuronidation (IEA) | GO:2001029
• regulation of complement-dependent cytotoxicity (IEA) | GO:1903659
• regulation of cytokinin dehydrogenase activity (IEA) | GO:1903856
• regulation of flavonoid biosynthetic process (IEA) | GO:0009962
• regulation of gastric motility (IEA) | GO:1905333
• regulation of germ cell proliferation (IEA) | GO:1905936
• regulation of hematopoietic progenitor cell differentiation (IEA) | GO:1901532
• regulation of hemicellulose catabolic process (IEA) | GO:2000988
• regulation of interleukin-10 secretion (IEA) | GO:2001179
• regulation of interleukin-27-mediated signaling pathway (IEA) | GO:0070107
• regulation of L-arginine import into cell (IEA) | GO:1902826
• regulation of leukocyte differentiation (IEA) | GO:1902105
• regulation of membrane lipid metabolic process (IEA) | GO:1905038
• regulation of microglial cell migration (IEA) | GO:1904139
• regulation of phosphatidylcholine biosynthetic process (IEA) | GO:2001245
• regulation of phosphorus utilization (IEA) | GO:0006795
• regulation of protein localization to cell division site (IEA) | GO:1901900
• regulation of Rho guanyl-nucleotide exchange factor activity (IEA) | GO:2001106
• regulation of secondary metabolic process (IEA) | GO:0043455
• regulation of transcription by RNA polymerase V (IEA) | GO:1904279
• regulatory T cell apoptotic process (IEA) | GO:1902482
• response to bacterial lipopeptide (IEA) | GO:0070339
• response to boron-containing substance (IEA) | GO:0010036
• response to ceramide (IEA) | GO:0106096
• response to methamphetamine hydrochloride (IEA) | GO:1904313
• response to molecule of oomycetes origin (IEA) | GO:0002240
• response to parasitic plant (IEA) | GO:0002241
• response to polyamine macromolecule (IEA) | GO:1904583
• response to propan-1-ol (IEA) | GO:1901427
• response to reactive oxygen species (IEA) | GO:0000302
• response to singlet oxygen (IEA) | GO:0000304
• ribonucleoside triphosphate biosynthetic process (IEA) | GO:0009201
• sesquiterpenoid biosynthetic process (IEA) | GO:0016106
• siderophore metabolic process (IEA) | GO:0009237
• signal transduction by p53 class mediator (IEA) | GO:0072331
• sodium-independent prostaglandin transport (IEA) | GO:0071720
• sperm aster formation (IEA) | GO:0035044
• sperm DNA decondensation (IEA) | GO:0035041
• sterol regulatory element binding protein cleavage involved in ER-nuclear sterol response pathway (IEA) | GO:0006992
• stilbene biosynthetic process (IEA) | GO:0009811
• sulfur amino acid biosynthetic process (IEA) | GO:0000097
• sulfur amino acid metabolic process (IEA) | GO:0000096
• superior colliculus development (IEA) | GO:0061380
• synaptic vesicle docking (IEA) | GO:0016081
• synaptic vesicle priming (IEA) | GO:0016082
• tertiary alcohol biosynthetic process (IEA) | GO:1902645
• tetrasaccharide transport (IEA) | GO:2001098
• transcription by RNA polymerase V (IEA) | GO:0001060
• triterpenoid catabolic process (IEA) | GO:0016105
• tRNA import into mitochondrion (IEA) | GO:0016031
• ureter development (IEA) | GO:0072189
• urethra epithelium development (IEA) | GO:0061071
• vacuolar acidification (IEA) | GO:0007035
• vulval cell fate determination (IEA) | GO:0072326
• vulval cell fate specification (IEA) | GO:0072327
• wing disc morphogenesis (IEA) | GO:0007472
• xanthophyll biosynthetic process (IEA) | GO:0016123
• xanthophyll catabolic process (IEA) | GO:0016124
• xylotriose transport (IEA) | GO:2001094

Domains

• ( PF00134 ) Cyclin, N-terminal domain

Gene Expression Profile

Vegetative Cell Cycle (Zhang et al., 2023)

GeneMania

No results were calculated for this gene in GeneMania.

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00933270(coding)
ATGTCTAAATTGCTTTCTTTTTTCTTAGTTGAAAACAAGCAATCAAATATTGTTTTTAAA
TAAAATATTTCATCAAAAACTACTAATCCAGCTGTGCCAATTCAAAAATAAAACAATTAA
TCCTCAGCTGCTATTATATAATCTGCTAACATAAATATCCATAATAATAAAAATAAAAAG
GTATAAAAATCTGAATGTAAAAGACAGCTAAAAATTACTTAACTCATGCAAAATACTAAG
TAAAGTCAACCTACTTAACCTTTTCAATAAATCAACAAATGCGGCTAAAAAATCATTAAT
AATAAACCTAAAGAATAATAATAATAATAAAAACTTAAATAAAACTCTATAATAATTTAA
ACTTCTTAATAATAAAAAACTGATTAAACAATATATAATTCACCTCCTTACTGTATGCTT
ACTTAAGAAGAAAAAGGGGGTCAACTAAATAATTTATAATAATATGTTGAGAAATAATAA
GTAAAACAGCTTAACCACAAACCAGCACAAATAGATTAATTTTCCTCTTCATCTTTATAA
AATTAAGAAACTGAGACTCAAATTACAAATGATTCACCTTGCTCTCCACCTTACTAAATA
TCTTCATCAAATAATCAAAATTTAAAATTAAAGAAAACAAAATTAAGAAGCTTTGAAAAA
GAAGAAGATATTTTAGTCAGCGAATTTGAAATAAACTTTTGCAAAAAAAAATGCTAAGAA
AGTTCACAATAAATCTTTGAAGCTTCTCCAGAATTTACTTAGGAGGGAGGATAGTAGTAA
ATTTTTGAATTCAGAAAAAAGCAAATTAGCTTTTTGTCTTAAAATACTTGTGATAATGAT
GAAAGCTACTTTACATCATTTAATGATAATTTTTAAGCAGCTTAAGATCTTTTTACTTGC
ACAGAAACTCTCTCTCCTAATTGTTTTGCTATGAATGAAAGTCCTTAATCTGATAGCGAA
ACATAAAAACTACAATTAAGTTAATAAAATAATAAATTATCTTTAAAAAATCGTCTTAAA
ATTATTGATTCTACCAGCAAACAATCTCATAAGAATGAATTAGATGATTTTGAGAAGAAT
ATAACAATCTAAAGTGCTGAGAAGGAGTTAAACTATTAGTAAGAATATATTGATAACTTG
ATGAAGCTAGAAAAAGATTACTATTTTGAATGCAGTATTTTTGAAAACAAAAACTGTCAA
ATTGACAGAAAAATGAGATATATTGTTATTAACTGGATATTTGAACTTTGTTCAGATTAT
AATTTAAATCGTTAAACATGCTAAACAGCTATCAATATTTTTGATAGATATATTTCAAAA
AAAATTAGCTCAATAAATAAATAAAATATTCAGTTGATCGCTGCAACTTGTGTTTATATT
TCTTCCAAAAAAGAAGAATAAGTCAGTCCTAAGCTAAAACATTTTATAGAATCTACAAAA
AATGTTTTTACTGTCAACTAATTCCTCAATCAAGAATTAGATATACTCAATATTCTCAAT
TTTAAAATTAATGGAGTTTGCTTTGAAGAATGGTTATAGAATATTTGCTAATATTGGGAT
GAATTTATAAATTAAGTTTAGAATTCTTAATATCACTAAAAAATCTACTTCAATAATAAG
ACTGAAGAATCTAAACTGAGATATTCTCAGCTTTAAAAAGTTATAGATTTAATACAATTA
GATGAAGAAAGCAATAATTATAATAAATCAAACATTGTTCTTGCTTTGATCTATTTGGTT
TATGGTATTTATTCTTAAGATTTCCTGCTAAATGACGTAGTGACTTATTTCTCTTCAATA
AATATGTATTACCATAGAGACTACTTCTAGCAATATAACAAATTAATGTTATCATTTAAG
CAATTCATTTTTATCAATAACGCTCACTTTTCAACTGCCTTAAATGAAGAATCTTTCATA
TAAGCTATTTAATATGTATCAAAATTTTTTGGATACTTTCAAAAACCTCAATAATCTCAA
AAGGTAATCGAAAACAACACTGAATGCATCTAAAAGCAATTTATTATTGAAAATGGATTA
GAATTCATACTTGATATGAAAAATTAATAACAAACTAAAAGTTCTTGA

>TTHERM_00933270(gene)
AATCTATAATTTTTTTTCTGAAAAAAGATTTTCTTTTGATTAGAAAAATATTGAACTTTA
TATAAATTACTCAAAGGAGTTCTCATTTTTCCTTAACTCGCGCTTACTACCAAGCTCTAA
GTCACACTAAAAACTCATTAAATAATACATATAAAACTATTACAAATGTCTAAATTGCTT
TCTTTTTTCTTAGTTGAAAACAAGCAATCAAATATTGTTTTTAAATAAAATATTTCATCA
AAAACTACTAATCCAGCTGTGCCAATTCAAAAATAAAACAATTAATCCTCAGCTGCTATT
ATATAATCTGCTAACATAAATATCCATAATAATAAAAATAAAAAGGTATAAAAATCTGAA
TGTAAAAGACAGCTAAAAATTACTTAACTCATGCAAAATACTAAGTAAAGTCAACCTACT
TAACCTTTTCAATAAATCAACAAATGCGGCTAAAAAATCATTAATAATAAACCTAAAGAA
TAATAATAATAATAAAAACTTAAATAAAACTCTATAATAATTTAAACTTCTTAATAATAA
AAAACTGATTAAACAATATATAATTCACCTCCTTACTGTATGCTTACTTAAGAAGAAAAA
GGGGGTCAACTAAATAATTTATAATAATATGTTGAGAAATAATAAGTAAAACAGCTTAAC
CACAAACCAGCACAAATAGATTAATTTTCCTCTTCATCTTTATAAAATTAAGAAACTGAG
ACTCAAATTACAAATGATTCACCTTGCTCTCCACCTTACTAAATATCTTCATCAAATAAT
CAAAATTTAAAATTAAAGAAAACAAAATTAAGAAGCTTTGAAAAAGAAGAAGATATTTTA
GTCAGCGAATTTGAAATAAACTTTTGCAAAAAAAAATGCTAAGAAAGTTCACAATAAATC
TTTGAAGCTTCTCCAGAATTTACTTAGGAGGGAGGATAGTAGTAAATTTTTGAATTCAGA
AAAAAGCAAATTAGCTTTTTGTCTTAAAATACTTGTGATAATGATGAAAGCTACTTTACA
TCATTTAATGATAATTTTTAAGCAGCTTAAGATCTTTTTACTTGCACAGAAACTCTCTCT
CCTAATTGTTTTGCTATGAATGAAAGTCCTTAATCTGATAGCGAAACATAAAAACTACAA
TTAAGTTAATAAAATAATAAATTATCTTTAAAAAATCGTCTTAAAATTATTGATTCTACC
AGCAAACAATCTCATAAGAATGAATTAGATGATTTTGAGAAGAATATAACAATCTAAAGT
GCTGAGAAGGAGTTAAACTATTAGTAAGAATATATTGATAACTTGATGAAGCTAGAAAAA
GATTACTATTTTGAATGCAGTATTTTTGAAAACAAAAACTGTCAAATTGACAGAAAAATG
AGATATATTGTTATTAACTGGATATTTGAACTTTGTTCAGATTATAATTTAAATCGTTAA
ACATGCTAAACAGCTATCAATATTTTTGATAGATATATTTCAAAAAAAATTAGCTCAATA
AATAAATAAAATATTCAGTTGATCGCTGCAACTTGTGTTTATATTTCTTCCAAAAAAGAA
GAATAAGTCAGTCCTAAGCTAAAACATTTTATAGAATCTACAAAAAATGTTTTTACTGTC
AACTAATTCCTCAATCAAGAATTAGATATACTCAATATTCTCAATTTTAAAATTAATGGA
GTTTGCTTTGAAGAATGGTTATAGAATATTTGCTAATATTGGGATGAATTTATAAATTAA
GTTTAGAATTCTTAATATCACTAAAAAATCTACTTCAATAATAAGACTGAAGAATCTAAA
CTGAGATATTCTCAGCTTTAAAAAGTTATAGATTTAATACAATTAGATGAAGAAAGCAAT
AATTATAATAAATCAAACATTGTTCTTGCTTTGATCTATTTGGTTTATGGTATTTATTCT
TAAGATTTCCTGCTAAATGACGTAGTGACTTATTTCTCTTCAATAAATATGTATTACCAT
AGAGACTACTTCTAGCAATATAACAAATTAATGTTATCATTTAAGCAATTCATTTTTATC
AATAACGCTCACTTTTCAACTGCCTTAAATGAAGAATCTTTCATATAAGCTATTTAATAT
GTATCAAAATTTTTTGGATACTTTCAAAAACCTCAATAATCTCAAAAGGTAATCGAAAAC
AACACTGAATGCATCTAAAAGCAATTTATTATTGAAAATGGATTAGAATTCATACTTGAT
ATGAAAAATTAATAACAAACTAAAAGTTCTTGAATATTTAATTATATTTAAAAAAATTTT
TTTAATTTACTAAAAAAACTATTTTGTACATTTTTAATACTTTATTTGTA

>TTHERM_00933270(protein)
MSKLLSFFLVENKQSNIVFKQNISSKTTNPAVPIQKQNNQSSAAIIQSANINIHNNKNKK
VQKSECKRQLKITQLMQNTKQSQPTQPFQQINKCGQKIINNKPKEQQQQQKLKQNSIIIQ
TSQQQKTDQTIYNSPPYCMLTQEEKGGQLNNLQQYVEKQQVKQLNHKPAQIDQFSSSSLQ
NQETETQITNDSPCSPPYQISSSNNQNLKLKKTKLRSFEKEEDILVSEFEINFCKKKCQE
SSQQIFEASPEFTQEGGQQQIFEFRKKQISFLSQNTCDNDESYFTSFNDNFQAAQDLFTC
TETLSPNCFAMNESPQSDSETQKLQLSQQNNKLSLKNRLKIIDSTSKQSHKNELDDFEKN
ITIQSAEKELNYQQEYIDNLMKLEKDYYFECSIFENKNCQIDRKMRYIVINWIFELCSDY
NLNRQTCQTAINIFDRYISKKISSINKQNIQLIAATCVYISSKKEEQVSPKLKHFIESTK
NVFTVNQFLNQELDILNILNFKINGVCFEEWLQNICQYWDEFINQVQNSQYHQKIYFNNK
TEESKLRYSQLQKVIDLIQLDEESNNYNKSNIVLALIYLVYGIYSQDFLLNDVVTYFSSI
NMYYHRDYFQQYNKLMLSFKQFIFINNAHFSTALNEESFIQAIQYVSKFFGYFQKPQQSQ
KVIENNTECIQKQFIIENGLEFILDMKNQQQTKSS