Identifiers and Description

Gene Model Identifier

TTHERM_00933270

Standard Name

CYC22 (CYClin 22)

Aliases

PreTt17926 | 168.m00094 | 3745.m00039

Description

CYC22 amine-terminal domain cyclin; Cyclin- N-terminal domain containing protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00134 ) cyclin, N-terminal domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_19477.1 9.997093137033517e-262
Description: cyclin domain-containing protein (693 aa)
Oxytricha Contig22153.0.g10 6.996829646809514e-23
Description: Cyclin, N-terminal domain
SGD YPR119W 0.00000000000008999700526206354
Description: CLB2 B-type cyclin involved in cell cycle progression; activates Cdc28p to promote the transition from G2 to M phase; accumulates during G2 and M, then targeted via a destruction box motif for ubiquitin-mediated degradation by the proteasome
WormBase WBGene00000871 0.00000000000009996062864481225
Description: locus:cye-1 G1/S-specific cyclin-E status:Confirmed UniProt:O01501 protein_id:CCD66922.1
Stentor Coeruleus SteCoe_12190 0.00000000003775134544279098
Description: None
DictyBase DDB_G0275493 0.0000000000499999055251093
Description: cycB on chromosome: 2 position 6000211 to 6001649

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00933270(coding)
ATGTCTAAATTGCTTTCTTTTTTCTTAGTTGAAAACAAGCAATCAAATATTGTTTTTAAA
TAAAATATTTCATCAAAAACTACTAATCCAGCTGTGCCAATTCAAAAATAAAACAATTAA
TCCTCAGCTGCTATTATATAATCTGCTAACATAAATATCCATAATAATAAAAATAAAAAG
GTATAAAAATCTGAATGTAAAAGACAGCTAAAAATTACTTAACTCATGCAAAATACTAAG
TAAAGTCAACCTACTTAACCTTTTCAATAAATCAACAAATGCGGCTAAAAAATCATTAAT
AATAAACCTAAAGAATAATAATAATAATAAAAACTTAAATAAAACTCTATAATAATTTAA
ACTTCTTAATAATAAAAAACTGATTAAACAATATATAATTCACCTCCTTACTGTATGCTT
ACTTAAGAAGAAAAAGGGGGTCAACTAAATAATTTATAATAATATGTTGAGAAATAATAA
GTAAAACAGCTTAACCACAAACCAGCACAAATAGATTAATTTTCCTCTTCATCTTTATAA
AATTAAGAAACTGAGACTCAAATTACAAATGATTCACCTTGCTCTCCACCTTACTAAATA
TCTTCATCAAATAATCAAAATTTAAAATTAAAGAAAACAAAATTAAGAAGCTTTGAAAAA
GAAGAAGATATTTTAGTCAGCGAATTTGAAATAAACTTTTGCAAAAAAAAATGCTAAGAA
AGTTCACAATAAATCTTTGAAGCTTCTCCAGAATTTACTTAGGAGGGAGGATAGTAGTAA
ATTTTTGAATTCAGAAAAAAGCAAATTAGCTTTTTGTCTTAAAATACTTGTGATAATGAT
GAAAGCTACTTTACATCATTTAATGATAATTTTTAAGCAGCTTAAGATCTTTTTACTTGC
ACAGAAACTCTCTCTCCTAATTGTTTTGCTATGAATGAAAGTCCTTAATCTGATAGCGAA
ACATAAAAACTACAATTAAGTTAATAAAATAATAAATTATCTTTAAAAAATCGTCTTAAA
ATTATTGATTCTACCAGCAAACAATCTCATAAGAATGAATTAGATGATTTTGAGAAGAAT
ATAACAATCTAAAGTGCTGAGAAGGAGTTAAACTATTAGTAAGAATATATTGATAACTTG
ATGAAGCTAGAAAAAGATTACTATTTTGAATGCAGTATTTTTGAAAACAAAAACTGTCAA
ATTGACAGAAAAATGAGATATATTGTTATTAACTGGATATTTGAACTTTGTTCAGATTAT
AATTTAAATCGTTAAACATGCTAAACAGCTATCAATATTTTTGATAGATATATTTCAAAA
AAAATTAGCTCAATAAATAAATAAAATATTCAGTTGATCGCTGCAACTTGTGTTTATATT
TCTTCCAAAAAAGAAGAATAAGTCAGTCCTAAGCTAAAACATTTTATAGAATCTACAAAA
AATGTTTTTACTGTCAACTAATTCCTCAATCAAGAATTAGATATACTCAATATTCTCAAT
TTTAAAATTAATGGAGTTTGCTTTGAAGAATGGTTATAGAATATTTGCTAATATTGGGAT
GAATTTATAAATTAAGTTTAGAATTCTTAATATCACTAAAAAATCTACTTCAATAATAAG
ACTGAAGAATCTAAACTGAGATATTCTCAGCTTTAAAAAGTTATAGATTTAATACAATTA
GATGAAGAAAGCAATAATTATAATAAATCAAACATTGTTCTTGCTTTGATCTATTTGGTT
TATGGTATTTATTCTTAAGATTTCCTGCTAAATGACGTAGTGACTTATTTCTCTTCAATA
AATATGTATTACCATAGAGACTACTTCTAGCAATATAACAAATTAATGTTATCATTTAAG
CAATTCATTTTTATCAATAACGCTCACTTTTCAACTGCCTTAAATGAAGAATCTTTCATA
TAAGCTATTTAATATGTATCAAAATTTTTTGGATACTTTCAAAAACCTCAATAATCTCAA
AAGGTAATCGAAAACAACACTGAATGCATCTAAAAGCAATTTATTATTGAAAATGGATTA
GAATTCATACTTGATATGAAAAATTAATAACAAACTAAAAGTTCTTGA


>TTHERM_00933270(gene)
ATGTCTAAATTGCTTTCTTTTTTCTTAGTTGAAAACAAGCAATCAAATATTGTTTTTAAA
TAAAATATTTCATCAAAAACTACTAATCCAGCTGTGCCAATTCAAAAATAAAACAATTAA
TCCTCAGCTGCTATTATATAATCTGCTAACATAAATATCCATAATAATAAAAATAAAAAG
GTATAAAAATCTGAATGTAAAAGACAGCTAAAAATTACTTAACTCATGCAAAATACTAAG
TAAAGTCAACCTACTTAACCTTTTCAATAAATCAACAAATGCGGCTAAAAAATCATTAAT
AATAAACCTAAAGAATAATAATAATAATAAAAACTTAAATAAAACTCTATAATAATTTAA
ACTTCTTAATAATAAAAAACTGATTAAACAATATATAATTCACCTCCTTACTGTATGCTT
ACTTAAGAAGAAAAAGGGGGTCAACTAAATAATTTATAATAATATGTTGAGAAATAATAA
GTAAAACAGCTTAACCACAAACCAGCACAAATAGATTAATTTTCCTCTTCATCTTTATAA
AATTAAGAAACTGAGACTCAAATTACAAATGATTCACCTTGCTCTCCACCTTACTAAATA
TCTTCATCAAATAATCAAAATTTAAAATTAAAGGTATTTAATTAATTTTTTAATAAATAA
ATAAATTTAGTTTTTAAATAATAATTTAAATATTTTAATTAAAAAAATAAATAAAAAATT
TAAAAACAAACTGGTTATTTCTGATAATTTATTAATATCTTTTTTATTTTATTAATAGAA
AACAAAATTAAGAAGCTTTGAAAAAGAAGAAGATATTTTAGTCAGCGAATTTGAAATAAA
CTTTTGCAAAAAAAAATGCTAAGAAAGTTCACAATAAATCTTTGAAGCTTCTCCAGAATT
TACTTAGGAGGGAGGATAGTAGTAAATTTTTGAATTCAGAAAAAAGCAAATTAGCTTTTT
GTCTTAAAATACTTGTGATAATGATGAAAGCTACTTTACATCATTTAATGATAATTTTTA
AGCAGCTTAAGATCTTTTTACTTGCACAGAAACTCTCTCTCCTAATTGTTTTGCTATGAA
TGAAAGTCCTTAATCTGATAGCGAAACATAAAAACTACAATTAAGTTAATAAAATAATAA
ATTATCTTTAAAAAATCGTCTTAAAATTATTGATTCTACCAGCAAACAATCTCATAAGAA
TGAATTAGATGATTTTGAGAAGAATATAACAATCTAAAGTGCTGAGAAGGAGTTAAACTA
TTAGTAAGAATATATTGATAACTTGATGAAGCTAGAAAAAGATTACTATTTTGAATGCAG
TATTTTTGAAAACAAAAACTGTCAAATTGACAGAAAAATGAGATATATTGTTATTAACTG
GATATTTGAACTTTGTTCAGATTATAATTTAAATCGTTAAACATGCTAAACAGCTATCAA
TATTTTTGATAGATATATTTCAAAAAAAATTAGCTCAATAAATAAATAAAATATTCAGTT
GATCGCTGCAACTTGTGTTTATATTTCTTCCAAAAAAGAAGTAAGTTAAACATTTTAGGT
GGGATAATGTTTTTTTAAAGATTTTTTTAATTAATAATTATAGGAATAAGTCAGTCCTAA
GCTAAAACATTTTATAGAATCTACAAAAAATGTTTTTACTGTCAACTAATTCCTCAATCA
AGAATTAGATATACTCAATGTAAATTTATGGTTAATTTTTTGATAAAATACTCATATTTG
TTTGAACTTATAATAAATAGATTCTCAATTTTAAAATTAATGGAGTTTGCTTTGAAGAAT
GGTTATAGAATATTTGCTAATATTGGGATGAATTTATAAATTAAGTTTAGAATTCTTAAT
ATCACTAAAAAATCTACTTCAATAATAAGACTGAAGAATCTAAACTGAGATATTCTCAGC
TTTAAAAAGTTATAGATTTAATACAATTAGATGAAGAAAGCAATAATTATAATAAATCAA
ACATTGTTCTTGCTTTGATCTATTTGGTTTATGGTATTTATTCTTAAGATTTCCTGCTAA
ATGACGTAGTGACTTATTTCTCTTCAATAAATATGTATTACCATAGAGACTACTTCTAGC
AATATAACAAATTAATGTTATCATTTAAGCAATTCATTTTTATCAATAACGCTCACTTTT
CAACTGCCTTAAATGAAGAATCTTTCATATAAGCTATTTAATATGTATCAAAATTTTTTG
GATACTTTCAAAAACCTCAATAATCTCAAAAGGTAATTGTTTTAAAACTTATTTTATTTT
AGTTACTTAATTTTATTTTTAAATATAAAAAAGGTAATCGAAAACAACACTGAATGCATC
TAAAAGCAATTTATTATTGAAAATGGATTAGAATTCATACTTGATATGAAAAATTAATAA
CAAACTAAAAGTTCTTGA


>TTHERM_00933270(protein)
MSKLLSFFLVENKQSNIVFKQNISSKTTNPAVPIQKQNNQSSAAIIQSANINIHNNKNKK
VQKSECKRQLKITQLMQNTKQSQPTQPFQQINKCGQKIINNKPKEQQQQQKLKQNSIIIQ
TSQQQKTDQTIYNSPPYCMLTQEEKGGQLNNLQQYVEKQQVKQLNHKPAQIDQFSSSSLQ
NQETETQITNDSPCSPPYQISSSNNQNLKLKKTKLRSFEKEEDILVSEFEINFCKKKCQE
SSQQIFEASPEFTQEGGQQQIFEFRKKQISFLSQNTCDNDESYFTSFNDNFQAAQDLFTC
TETLSPNCFAMNESPQSDSETQKLQLSQQNNKLSLKNRLKIIDSTSKQSHKNELDDFEKN
ITIQSAEKELNYQQEYIDNLMKLEKDYYFECSIFENKNCQIDRKMRYIVINWIFELCSDY
NLNRQTCQTAINIFDRYISKKISSINKQNIQLIAATCVYISSKKEEQVSPKLKHFIESTK
NVFTVNQFLNQELDILNILNFKINGVCFEEWLQNICQYWDEFINQVQNSQYHQKIYFNNK
TEESKLRYSQLQKVIDLIQLDEESNNYNKSNIVLALIYLVYGIYSQDFLLNDVVTYFSSI
NMYYHRDYFQQYNKLMLSFKQFIFINNAHFSTALNEESFIQAIQYVSKFFGYFQKPQQSQ
KVIENNTECIQKQFIIENGLEFILDMKNQQQTKSS