Identifiers and Description

Gene Model Identifier

TTHERM_00940290

Standard Name

CYC9 (CYClin 9)

Aliases

PreTt25135 | 171.m00044

Description

CYC9 amine-terminal domain cyclin; Cyclin- N-terminal domain containing protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00134 ) cyclin, N-terminal domain
  • ( PF02984 ) Cyclin, C-terminal domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_19580.1 3.998261333760679e-157
Description: cyclin domain-containing protein (408 aa)
Oxytricha Contig14947.0.g37 6.0018235484001396e-36
Description: Cyclin, N-terminal domain
SGD YLR210W 0.00000000030007160092483236
Description: CLB4 B-type cyclin involved in cell cycle progression; activates Cdc28p to promote the G2/M transition; may be involved in DNA replication and spindle assembly; accumulates during S phase and G2, then targeted for ubiquitin-mediated degradation
WormBase WBGene00000865 0.000000000500206551404915
Description: locus:cyb-1 G2/mitotic-specific cyclin-B1 status:Confirmed UniProt:Q10653 protein_id:CAA94384.1
DictyBase DDB_G0279085 0.000000600201742947405
Description: cycA on chromosome: 3 position 1598641 to 1600602

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00940290(coding)
ATGCTTCATTATATTTTCAATTATTTTATAACGATTTAAATAATAACCACTAATCAATAT
TTGTTTAATAATTAATTATAAAATCAAAAAAAATAATAAATAATATAAAAAAACCTTTTG
CTTGCAAATAATCTAAATACTATTGATTTCGTGATTAAATAAATGGAAGACTAGAACAAT
AACAATAACAACAACAACAACAAAAATCCCAACAAAAAGGACATTCCTAAAATTGGACCT
AAGCTCTAAAACAATAAATAATGCAACAAGAAGTCACAAAACAGTGCTTTGATGTTCCTT
TCTACCTCTAAAATGGAACAAGAGGAAATCTTAAAAGAAAAAAAGCTAGAGAAGGCTAAA
AAGAACTTAAAGATTGGATTCACTAGTGGATAAATTATCTGCGAAAGCTAAATTGATAAA
GAGAATTTCATGGAGGATGATAAATAAGAAATTGCCTTTTATGAAGAGCAATAAAACATA
ATGGAGGAAGACGAAGACGATTCTTTTGATAGTGAGGAAGGAAATTAACAAATTGGCTAA
CACTTTAATAGCGATAAACTTCGTGATAGATAATGGAGGTACAATTAACTATATGGAGAT
TATGAGGATTTAAATCTCCTCAATCAAGAAGTTGATTTATCTAATTGCCTCAAGAACCAT
AAAATTCCTTCAATTCTAAGATCTAAAATGGTTGATTGGATGATTGAAGTTTTTGGTAAT
TACAAGCAAACATCTTCCGATAAAACCTACTTTCGTGCTGTTGGTCTTCTTGATTTATTT
TTTAAGAAATAAACAAAAAAACTTGTTGAATCAGATGTTCATTTATTTGGTATTGCAGCT
ATGTTCTTAGCCACAAAGCAAGAAGACATTTCTCACATCAGTCTAGATGATATTGTTGAA
AAAGTTGGACACAACAAATTTACTGAGAAAAAGATAAGAGAAGCAGAATATGAAATTTTA
AGAATTGTTGATATGAAAATAGATTTCCCAACAACTCATACTTATCTGAATCGCTATTTA
TATAAAATATTCTCTTCTGAAACAAACCAAACAATTTTATAGCTAACTCACTTTTCACTC
TATATTTTGAAGTAATGTGTTCATGATGACAAATTATTAGATTACAAATCTCACATACTA
GCTTTCTCGGCTATAGTAGTTTCACTAAAAGTTTATTTTTCGAATTTAAAAGGCGACAGT
ATTTCTCCTTATAACGATTTGATTTAACAAGAAGTTTAAATTATGGAGAAAATGTTTGAG
CTTATATCCTAATCTGAACATTAAAATGCTAAAGAATGCATTTAAAGGGTTAATAACTTT
GTCTTTTCTTTTAACCAAAGGTATCCTGAACTTAGAAATCTCGAGAAATTCCACTATTGA


>TTHERM_00940290(gene)
ATGCTTCATTATATTTTCAATTATTTTATAACGATTTAAATAATAACCACTAATCAATAT
TTGTTTAATAATTAATTATAAAATCAAAAAAAATAATAAATAATATAAAAAAACCTTTTG
CTTGCAAATAATCTAAATACTATTGATTTCGTGATTAAATAAATGGAAGACTAGAACAAT
AACAATAACAACAACAACAACAAAAATCCCAACAAAAAGGACATTCCTAAGTAAGATTTT
TAATTATTTACTGCTTTTGCTTAACCTGCTTTTAATTTTAGAATTGGACCTAAGCTCTAA
AACAATAAATAATGCAACAAGAAGTCACAAAACAGTGCTTTGATGTTCCTTTCTACCTCT
AAAATGGAACAAGAGGAAATCTTAAAAGAAAAAAAGCTAGAGAAGGCTAAAAAGAACTTA
AAGATTGGATTCACTAGTGGATAAATTATCTGCGAAAGCTAAATTGATAAAGAGAATTTC
ATGGAGGATGATAAATAAGAAATTGCCTTTTATGAAGAGCAATAAAACATAATGGAGGAA
GACGAAGACGATTCTTTTGATAGTGAGGAAGGAAATTAACAAATTGGCTAACACTTTAAT
AGCGATAAACTTCGTGATAGATAATGGAGGTACAATTAACTATATGGAGATTATGAGGAT
TTAAATCTCCTCAATCAAGAAGTAAACATTTTTTTCATTTTATTTATCTATCTATCTATC
TTCTTTTTTGTTTTGCTGGTATTTGTTTAATTATATTAAGCTCTTTGAGACAACAGATTA
TTCAGTATTTAATAGTTTTATCATTAGAATAATCAGATTTTTTGTTGTTGTATCTTTGAT
TAATTCAAAAGATACCTTAATTTAAAAAAGATTTTTTCTAGAAAAATTAATAATGTTTTT
AAAACCAAAGGTTGATTTATCTAATTGCCTCAAGAACCATAAAATTCCTTCAATTCTAAG
ATCTAAAATGGTTGATTGGATGATTGAAGTTTTTGGTAATTACAAGCAAACATCTTCCGA
TAAAACCTACTTTCGTGCTGTTGGTCTTCTTGATTTATTTTTTAAGAAATAAACAAAGTA
AAAACTTAAAATTACTTTCTTCCCAAAATCTAATTTATCTTTAGGATTCACTTTAAAGAA
ATGAATGTCTTAACTTCAAGATTATCTACGAAATTTAATAATTTCCCAAACAAAAATATG
TTTTTAACCATTAAAATTTATTTTAACATTTTTTAACCCTTTTTAAATTTTGTTTAAAAT
TAATTAATTTGTAAAATAGAAAACTTGTTGAATCAGATGTTCATTTATTTGGTATTGCAG
CTATGTTCTTAGCCACAAAGCAAGAAGACATTTCTCACATCAGTCTAGATGATATTGTTG
AAAAAGTTGGACACAACAAATTTACTGAGTAAATATTTATTATTAATATCTTTTTTCTAA
AATATTTTACTTGATTCTTTTAACTAACTAACATTTTGGTTCCTTCCAAATAATTTTAAA
ATTTGTATGATTGCTTTTAATCCTGCTCTAAAATAATTTCAAAACAAACTAAAAAATAGG
AAAAAGATAAGAGAAGCAGAATATGAAATTTTAAGAATTGTTGATATGAAAATAGATTTC
CCAACAACTCATACTTATCTGAATCGCTATTTATATAAAATATTCTCTTCTGAAACAAAC
CAAACAATTTTATAGCTAACTCACTTTTCACTCTATATTTTGAAGTAATGTGTTCATGAT
GACAAATTATTAGATTACAAATCTCACATACTAGCTTTCTCGGCTATAGTAGTTTCACTA
AAAGTTTATTTTTCGAATTTAAAAGGCGACAGTATTTCTCCTTATAACGATTTGATTTAA
CAAGAAGTTTAAATTGTATTTATTTTTTATTTATTTTCAATAAAACTCATTTCTAAATTT
ATATTTTACATATAAATAGATGGAGAAAATGTTTGAGCTTATATCCTAATCTGAACATTA
AAATGCTAAAGAATGCATTTAAAGGGTTAATAACTTTGTCTTTTCTTTTAACCAAAGGTA
TCCTGAACTTAGAAATCTCGAGAAATTCCACTATTGA


>TTHERM_00940290(protein)
MLHYIFNYFITIQIITTNQYLFNNQLQNQKKQQIIQKNLLLANNLNTIDFVIKQMEDQNN
NNNNNNNKNPNKKDIPKIGPKLQNNKQCNKKSQNSALMFLSTSKMEQEEILKEKKLEKAK
KNLKIGFTSGQIICESQIDKENFMEDDKQEIAFYEEQQNIMEEDEDDSFDSEEGNQQIGQ
HFNSDKLRDRQWRYNQLYGDYEDLNLLNQEVDLSNCLKNHKIPSILRSKMVDWMIEVFGN
YKQTSSDKTYFRAVGLLDLFFKKQTKKLVESDVHLFGIAAMFLATKQEDISHISLDDIVE
KVGHNKFTEKKIREAEYEILRIVDMKIDFPTTHTYLNRYLYKIFSSETNQTILQLTHFSL
YILKQCVHDDKLLDYKSHILAFSAIVVSLKVYFSNLKGDSISPYNDLIQQEVQIMEKMFE
LISQSEHQNAKECIQRVNNFVFSFNQRYPELRNLEKFHY