Identifiers and Description

Gene Model Identifier

TTHERM_00941450

Standard Name

RPB5 (RNA polymerase II subunit 5)

Aliases

PreTt25151 | 171.m00060

Description

RPB5 RNA polymerase Rpb5 carboxy-terminal domain protein; Subunit shared in RNA polymerases I- II & III

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF01191 ) RNA polymerase Rpb5, C-terminal domain
  • ( PF03871 ) RNA polymerase Rpb5, N-terminal domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_19596.1 7.996706633065278e-159
Description: RNA polymerase Rpb5 domain-containing protein (277 aa)
WormBase WBGene00019246 6.999211576891585e-27
Description: locus:rpb-5 DNA-directed RNA polymerases I, II, and III subunit RPABC1 status:Confirmed UniProt:Q9N5K2 protein_id:CCD72467.1
DictyBase DDB_G0291636 9.998720540547892e-23
Description: rpb5 on chromosome: 6 position 457932 to 458567
Oxytricha Contig486.1.g67 9.998720540547892e-23
Description: RNA polymerase Rpb5, C-terminal domain
SGD YBR154C 1.0002869940498747e-21
Description: RPB5 RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III; contacts DNA and affects transactivation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00941450(coding)
ATGAGCGAGGATTAGAGAAAGAGTGCCTAAAAGTGGTTTAAGGTTTACCGCACTATTTGC
GAAATGGCCAGAGATAGAGGATACAGCGAAGAAGCTGAGCAATAGTTGAATCTGATTAAA
ACTAAGGAATAGGAAAATATGTGGATTTAAAACAGCATGTCTAACGTTCAAAACAGTTTA
ACCATAAATTCTTTTTCACATGATGCTAACCAAACTGATGAACACAAATTTTTAGGAATG
GAATAGCACCTTTACGTTTTCCATAGCTAAACTAAGTTAACCGATGATATACTTAGCTCA
TATGATAAGACTATTTAAAAATATCACGAGTCTTCTATTAAAAACAATCCTTAATTGAAC
GTTTTTATTAATGTTGTTATTCTTGTCCCAGAAGAAAAAGATATCGTCACTAAGAAAGTT
TAAGATATCATTCTCATCTCAAACAAGTATTTTAAAGATAGAATTGAACTCTTTGAAAAG
AGATAGGTTGAAATGAACTTCAACAGTAAAAAGTAAACTGATATTAAATCTGAAACAGAT
GATAAAGGCGATGTCATTTAAATCTTCTATAAATATGAAATTTTCTTCTTTGATGATCTT
GTCATTAACATCACCAAGCATCAATTAGTTCCTAAGCACGTACCCTTGAATGCCATCGAA
AAGAAAAAATTAATGGATAAATACAAAATTAACGATGCTTAACTCCCTAAGATCCTTTCC
ACCGACCCAATTACAAAATATTTTGGATTAAGGACAAAGCAAGTTTTCAAAATAGAAAGA
GATTCTGAAACTGCTGGTAAATATATTACTTATAGAATTGTTAGTTGA


>TTHERM_00941450(gene)
ATGAGCGAGGATTAGAGAAAGAGTGCCTAAAAGTGGTTTAAGGTTTACCGCACTATTTGC
GAAATGGCCAGAGATAGAGGTAATCTAATTTAACTAATAAATTAAATAACTCTTAGTTCG
AAATATGCATACTTTCATTTCAAAATTTTCAGATGATCGTAGTGCACAATATTGTTAAAA
AAAGCCTTTTGTATAAAAGATAAGTGTATTAATAAGATTTTATGCAAGCGAATGATAAGC
AAAATTAATTAATTAAAATATTTTTCAGAAACAAAATAAAAAGATTAAGTTTGTTGATAA
ATAAACTGCAACTATAAAATAAATAATCTGAATTTAGCTATTTAATTGAATTTTTTATCT
TGCTAATTAAAGGATACAGCGAAGAAGCTGAGCAATAGTTGAATCTGATTAAAACTAAGG
AATAGGAAAATATGTGGATTTAAAACAGCATGTCTAACGTTCAAAACAGTTTAACCATAA
ATTCTTTTTCACATGATGCTAACCAAACTGATGAACACAAATTTTTAGGAATGGAATAGC
ACCTTTACGTTTTCCATAGCTAAACTAAGTTAACCGATGATATACTTAGCTCATATGATA
AGACTATTTAAAAATATCACGAGTCTTCTATTAAAAACAATCCTTAATTGAACGTTTTTA
TTAATGTTGTTATTCTTGTCCCAGAAGAAAAAGATATCGTCACTAAGAAAGTTTAAGATG
TACTTAAATTTTTTATTTCTAGACACATTGCTTTCTACTTGATTTTATTATATTAATAAA
TTAATAAATAAATAAATTGGATTATTAGAATTATTTTATTTTAGAATATCTTATTAAAAT
AATTTGAAAAATTTACTAAAAACATTTTTAATCAATAATAATTATAGATCATTCTCATCT
CAAACAAGTATTTTAAAGATAGAATTGAACTCTTTGAAAAGAGATAGGTTGAAATGAACT
TCAACAGTAAAAAGTAAACTGATATTAAATCTGAAACAGATGATAAAGGCGATGTCATTT
AAATCTTCTATAAATATGAAATTTTCTTCTTTGATGATCTTGTCATTAACATCACCAAGC
ATCAATTAGTTCCTAAGCACGTACCCTTGAATGCCATCGAAAAGAAAAAATTAATGGATA
AATAGTAAAAAAATATTTTTTTTATTTGTATTTCGTTTAAACAATTTTTTTAATAAAAGC
AAAATTAACGATGCTTAACTCCCTAAGATCCTTTCCACCGACCCAATTACAAAATATTTT
GGATTAAGGACAAAGCAAGTAATAAATTTAAAATAAAAAATAAATGGCAATAATATTAAT
TATTAACTATAAATTTACTAGGTTTTCAAAATAGAAAGAGATTCTGAAACTGCTGGTAAA
TATATTACTTATAGAATTGTTAGTTGA


>TTHERM_00941450(protein)
MSEDQRKSAQKWFKVYRTICEMARDRGYSEEAEQQLNLIKTKEQENMWIQNSMSNVQNSL
TINSFSHDANQTDEHKFLGMEQHLYVFHSQTKLTDDILSSYDKTIQKYHESSIKNNPQLN
VFINVVILVPEEKDIVTKKVQDIILISNKYFKDRIELFEKRQVEMNFNSKKQTDIKSETD
DKGDVIQIFYKYEIFFFDDLVINITKHQLVPKHVPLNAIEKKKLMDKYKINDAQLPKILS
TDPITKYFGLRTKQVFKIERDSETAGKYITYRIVS