Identifiers and Description

Gene Model Identifier

TTHERM_00954180

Standard Name

SEH1 (nucleoporin Seh1)

Aliases

PreTt04994 | 176.m00067 | Seh1

Description

nucleoporin putative; Nucleoporin common to both MAC and MIC NPCs

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_13504.1 9.997093137033517e-262
Description: hypothetical protein (369 aa)
Oxytricha Contig17748.0.g4 4.001118334825066e-42
Description: WD domain, G-beta repeat
DictyBase DDB_G0277257 3.000619078166531e-39
Description: DDB_G0277257 on chromosome: 2 position 7833225 to 7834846
WormBase WBGene00003804 3.99801309251602e-27
Description: locus:npp-18 Nucleoporin SEH1 status:Confirmed UniProt:O45933 protein_id:CAA16333.1
SGD YLR208W 5.00179831534194e-27
Description: SEC13 Component of the Nup84 nuclear pore sub-complex, the Sec13p-Sec31p complex of the COPII vesicle coat, and the SEA (Seh1-associated) complex; required for vesicle formation in ER to Golgi transport and nuclear pore complex organization; the Nup84 subcomplex has a role in transcription elongation

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25788697: Iwamoto M, Koujin T, Osakada H, Mori C, Kojidani T, Matsuda A, Asakawa H, Hiraoka Y, Haraguchi T (2015) Biased assembly of the nuclear pore complex is required for somatic and germline nuclear differentiation in Tetrahymena. Journal of cell science 128(9):1812-23
  2. Ref:19375312: Iwamoto M, Mori C, Kojidani T, Bunai F, Hori T, Fukagawa T, Hiraoka Y, Haraguchi T (2009) Two distinct repeat sequences of Nup98 nucleoporins characterize dual nuclei in the binucleated ciliate tetrahymena. Current biology : CB 19(10):843-7

Sequences

>TTHERM_00954180(coding)
ATGAATTAGGAAGGATTTCAAGCAATCAACACTTTTCATTAAGATATAATACACGATATA
TCATTTGACTGGTATGGTTAAAGACTAGTCACTTGTTCATCTGACAGAAATGTAAAAATT
TGGCATAAAAACTAATCAGGAAAATGGGATTTATACCACTCAATCACTAATCAAGAAGGT
CCAGTTAGGAAAGTAAAATGGGCTCATCCTTAATTTGGAACTATTTTGGCTGCATGCTCA
ATGGATCGCTCTATTCATATTTATTAAGAATATAAAGATATTACTTCAATACAAAAGGAT
CCCAATGAATAATAATTATAAAAATAATGGAAACCCATCAAAATCTATAACGACAAAGAA
GTTATTGAAGACATGAAATTTGCTCCTATACATGTTGGTTTAATATTAGCTGTTGCAAGA
GCTGATGGAAGGATTAGTATTTTCCAATTTAAAGATCTTTTGAACTTACAAATTCATGAG
CAAATCTCGAATATCTCTGTCTCTCCTTTAGGAATTAATAGTATTTCTTGGAACAAAAAT
AGATTTGATAAGAAGCATATGATTGCAGTCGGATGTAAAGATAGAGATACATCTCAAACT
AAAAATTAAAATGGAATTAACGGCGTCAATTAAAAGTATATCGATGAAGAAATCAAATCC
GGTTAATCCTTCAAAATTATTGTCTTCAACAGTCTTTAAACTGTAAATGCTTAAGATCAC
TATCAAATGAAATTTGAATTCCAAGAAAGCAATGCTTAATAACTTATGCACACCTAAAAT
GTAAGTGATGTATCCTGGAGTTTAATAAATGGAAGATCTTTTCATTTAATTGCAACATGT
GGTAAAGAAGGAGCCAGAATTTGGTACATGAAACAATTATCTACAAACTAAAATGTCATA
TAAGTTATTAAAGTTATTGACTTGTTTGATCAAAATTACAGAGAAAGCATTGAAGTCCAA
AAGATATCTTGGAATATTATGGCTTCACTAGTAGCAACCTCTGACAGCAACAACGAAATT
AAAATCTTTAAATGTGTCGGAATGGGTAAATGGGAAAAAATTAAGAGTATTAAAGAAACT
TAGGATTCAGAATAATGA


>TTHERM_00954180(gene)
ATGAATTAGGAAGGATTTCAAGCAATCAACACTTTTCATTAAGATATAATACACGATATA
TCATTTGACTGTAATTATTTATTTACATTAGCAATCAAACCAATTAAAAGTAGCAATAAA
ACAGCTAGAAAAACAAATTAATGCTTTTGAAATTAGCTTATTAAAGCACATATTTGATTC
GATTTGAATGATAAATTTATCAAATAAAAATATTTCATGAAAATGCAGATATTTTATCTA
GACAAAGAGTAAATATACTTTTATAATCAAGCAATTCTTCTCCTTAAAAGTATAAATAAA
ATTATTTAGCTGGCAGAGTGCTTAGTTTAAAAAATAAGGATTTGTTCAAAAAATAATTAT
TAAGATTATTAATCTCGCTTTAAGATTTATTGATGAATTAACAAGCTAAATTCATAAAAG
ATAAAAAATTATTCAGGTATAGCTATATAGTTCTCCATGATATTAGGAGAGTATATCTTG
AATACCCCATTTCTCTTTATCCCTCGTTTGACTCCACTTCAACTATTTAAGTCATAGCGG
CAACACTTAAGGGAATGAATTTTTTCTACACTTATTTTTTTACTAATTAAATTAATTAAA
TAATTTTGTTAGTATGAATCAATCATAGCTAAAATCTTTAGCAAGATATCTTATTAAATA
AAGAAAAGCTAGCATTAATTAATTATCTTACCTAACATTTATTTATAATCAATTCATAAA
ATCAATTAAATATCTTATGGGTTTGCTTTCTAATCAATTTTTATTCACATTAACAAATAA
ACAAAAAAACAAACAAATAAATAAATAGAATCAAAAACTTGATTTTTTTTATTCAAATTT
TATTTATAAATGGTTTCTTATATTATTTTTAGTTTTTTTAGCTGTTTTTGCAATTAATTT
ACAATAAAAAATTTAATTTTGGAATAAATTTATTTTAAAACAAATAAATTGTTTTAAACC
TGAATGAATTTTAAATTTTATTTACTTATTTTTAAATTAATTAATTATTAATTTCTTTAT
TATTTTAATGCTTGATTAAAGGGTATGGTTAAAGACTAGTCACTTGTTCATCTGACAGAA
ATGTAAAAATTTGGCATAAAAACTAATCAGGAAAATGGGATTTATACCACTCAATCACTA
ATCAAGAAGGTCCAGTTAGGAAAGTAAAATGGGCTCATCCTTAATTTGGAACTATTTTGG
CTGCATGCTCAATGGATCGCTCTATTCATATTTATTAAGAATATAAAGATATTACTTCAA
TACAAAAGGATCCCAATGAATAATAATTATAAAGTAATTTATTTTTCTTTTAAAGATTTA
AATTAAAATTTTTTGTTTTAGAATAATGGAAACCCATCAAAATCTATAACGACAAAGAAG
TTATTGAAGACATGAAATTTGCTCCTATACATGTTGGTTTAATATTAGCTGTTGCAAGAG
CTGATGGAAGGATTAGTATTTTCCAATTTAAAGATCTTTTGAACTTACAAATTCATGAGC
AAATCTCGAATATCTCTGTCTCTCCTTTAGGAATTAATAGTATTTCTTGGAACAAAAATA
GATTTGATAAGAAGCATATGATTGCAGTCGGATGTAAAGATAGAGATACATCTCAAACTA
AAAATTAAAATGGAATTAACGGCGTCAATTAAAAGTATATCGATGAAGAAATCAAATCCG
GTTAATCCTTCAAAATTATTGTCTTCAACAGTCTTTAAACTGTAAATGCTTAAGATCACT
ATCAAATGAAATTTGAATTCCAAGAAAGCAATGCTTAATAACTTATGCACACCTAAAATG
TAAGTGATGTATCCTGGAGTTTAATAAATGGAAGATCTTTTCATTTAATTGCAACATGTG
GTAAAGAAGGAGCCAGAATTTGGTACATGAAACAATTATCTACAAACTAAAATGTCATAT
AAGTTATTAAAGTTATTGACTTGTTTGATCAAAATTACAGAGAAAGCATTGAAGTCCAAA
AGATATCTTGGAATATTATGGCTTCACTAGTAGCAACCTCTGACAGCAACAACGAAATTA
AAATCTTTAAATGTGTCGGAATGGGTAAATGGGAAAAAATTAAGAGTATTAAAGAAACTT
AGGATTCAGAATAATGA


>TTHERM_00954180(protein)
MNQEGFQAINTFHQDIIHDISFDWYGQRLVTCSSDRNVKIWHKNQSGKWDLYHSITNQEG
PVRKVKWAHPQFGTILAACSMDRSIHIYQEYKDITSIQKDPNEQQLQKQWKPIKIYNDKE
VIEDMKFAPIHVGLILAVARADGRISIFQFKDLLNLQIHEQISNISVSPLGINSISWNKN
RFDKKHMIAVGCKDRDTSQTKNQNGINGVNQKYIDEEIKSGQSFKIIVFNSLQTVNAQDH
YQMKFEFQESNAQQLMHTQNVSDVSWSLINGRSFHLIATCGKEGARIWYMKQLSTNQNVI
QVIKVIDLFDQNYRESIEVQKISWNIMASLVATSDSNNEIKIFKCVGMGKWEKIKSIKET
QDSEQ