Identifiers and Description

Gene Model Identifier

TTHERM_00961880

Standard Name

EFR2 (Elongation Factor 2 Related 2)

Aliases

PreTt23676 | 178.m00057

Description

EFR2 translation elongation factor EF-2 subunit; Elongation factor 2 related protein; expressed only during conjugation- significant amino acid identity to EF-2 ifrom other eukaryotes but with differences at some residues that are typically post-translational regulation sites

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886

Biological Process

Domains

  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( PF00167 ) Fibroblast growth factor
  • ( PF00679 ) Elongation factor G C-terminus
  • ( PF01926 ) GTPase of unknown function
  • ( PF03144 ) Elongation factor Tu domain 2
  • ( PF03764 ) Elongation factor G, domain IV
  • ( PF04644 ) Motilin/ghrelin
  • ( PF05705 ) Eukaryotic protein of unknown function
  • ( PF08477 ) Miro-like protein
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR00475 ) selenocysteine-specific translation elongation factor
  • ( TIGR00483 ) translation elongation factor EF-1, subunit
  • ( TIGR00484 ) translation elongation factor G
  • ( TIGR00485 ) translation elongation factor Tu
  • ( TIGR00490 ) translation elongation factor aEF-2
  • ( TIGR00503 ) peptide chain release factor 3
  • ( TIGR01393 ) GTP-binding protein LepA
  • ( TIGR01394 ) GTP-binding protein TypA/BipA

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_7852 0
Description: None
WormBase WBGene00001167 9.997093137033517e-262
Description: locus:eef-2 Elongation factor 2 status:Confirmed UniProt:P29691 protein_id:CAB02985.1
Tetrahymena borealis EI9_08465.1 9.997093137033517e-262
Description: elongation factor G, domain IV family protein (842 aa)
DictyBase DDB_G0287685 9.997093137033517e-262
Description: cinC on chromosome: 5 position 689907 to 692602
Oxytricha Contig22552.0.g51 9.997093137033517e-262
Description: Elongation factor Tu GTP binding domain
SGD YOR133W 9.997093137033517e-262
Description: EFT1 Elongation factor 2 (EF-2), also encoded by EFT2; catalyzes ribosomal translocation during protein synthesis; contains diphthamide, the unique posttranslationally modified histidine residue specifically ADP-ribosylated by diphtheria toxin

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:14729267: Malavé TM, Forney JD (2004) Identification of a developmentally regulated translation elongation factor 2 in Tetrahymena thermophila. Gene 326( ):97-105
  2. Ref:12673598: Ueno H, Gonda K, Takeda T, Numata O (2003) Identification of elongation factor-1alpha as a Ca2+/calmodulin-binding protein in Tetrahymena cilia. Cell motility and the cytoskeleton 55(1):51-60

Sequences

>TTHERM_00961880(coding)
ATGAAGACTCTCCAGATTGAGAAGATAAGAGAACTCATGATGAACCCCAATCAAATCAGA
AATATGTCTGTCATAGCCCACGTTGATCATGGTAAGACTACTTTAACTGATTCTTTGTTA
GCTAGAGCTGGTATCATCTCAGAAAGCAACGCTGGTAAAGCCTGCATGATGGATACTGAC
CCAAAAGAACAAAAAATGGGAATCACCATTAAGTCAACTGGAGTTTCCTTATACTATCAA
AATACTGTGACCAAGTAGGAGAGTATCATTAATTTGATTGATTCTCCAGGTCATATTGAC
TTTTCTGGTGAAGTTACTGCTGCATTAAGAGTTACTGATGGAGCTCTTGTTGTGGTAGAT
GCTGTTGAAGGTGTTGCTGTTCAAACAGAAACAGTTCTAAGGCAGGCTTGCCAAGAACGA
ATACGACCCGTTCTTGTAATTAATAAGCTAGACAGACTATTTAGTGAGCTTAAGGATGAT
TATGAAAATATTTATCAAAGATTAGTAGAGATCATAGCAAGGATTAATTCTATCTTGGAA
ATGAACGAAAATGAATCTATTAAAGGCTACACTTTAGATCCCTCACTTGGAAATGTTGCT
TTCTCTTCTGGTAAACAGTGCTGGGGATTCACTTTAAAGACTTTTGCTAGAATTTATAGT
CAAAAATTCTCAACAAAGGAAGAAACTTTAATGACTAAATTATGGGGAGACAACTATTTT
AATCCTCAAACAAAGTAATTCACCTCAGAATTAATCAGTAATAATACCTAAAACAAGTAA
GCTAGTCGTTCATTCATTGAATTCGTTTTAGTTCCTTTAGATAAGTACTATTCAGCCTCT
TCAAATGCAGAAATTGAAACTCTTTCCAAGATGGTTGAAAAGCTCAACCTTTCTTCCATT
CTAACTTCAGCTGAATTAGAAAGACTCAAATAGGTTGATGTTCAAGAGAGAATCAAGAGG
TCTATGAGGGCTTGGTTACCCTTAGCCGATGCCATACTTGAAATGGTCTAAGATCATTTA
CCTTCACCAAAAGAGGCTATGAAATATCGTAGTTTGTATCTTTACGAAGGACCTGCTGGT
GATGAGGCTTGTGCAGCAATGAGAGAATGTAATTCTGAGGGACCTCTCATGGTTTACATT
TCAAAAATGGTTTAAACTGAAGATCTTGGTAGATTTTATGCTTTTGGTAGAGTATTCAGT
GGCACAATATCTCAAGGCATGAAAGTCAGAGTCTAAGGTCCTGACTATAAACCTGGAAGC
AAAGAAGATCTCTTTATCAAAACAATCTAGCATACATTTTTGATGATGGGTAAACAGCAT
GAGCCTATCGAATCAGTACCAGCTGGAGGTACCGTCCTCATCTTAGGTGTTGATAACGCT
CTTACTAAAACAGGAACTCTTACAACTTCAGAAACAGCACATAATATCAGAAACATGAAG
TACACGATTTCACCTATATTGAGAGTTGCTGTCAATACTCCTAACTAACAAGATCTTACA
CGTCTACTTGAAGGTCTTAAGATGCTTCAAAAATATGATCCTCTTGTTCAAGTAGAAGTT
GAAGAAAATACAGGATCCTATGTTGTTGCTGGTAGTGGTGAATTGCATATTAAAATTTGC
TTAGAAAAACTGAATGATTTCACCCACAACTCTATTAATATTGTTGCTTCTCAACCCACT
GTATCTTACAGAGAAACAATAGCTGAAAAGAGCTCTTAAACTTGCCTAGCTAAGACTGAA
AATAAGCTTAATCATCTGTATGGTACTTGCGAACCACTTGATGAAGAATTAGGATCAGCA
ATAGTGAGCAAAAAAATAAATATTAAAGACATTAACAACTAAAAAATGATTAACAGTTTG
GTGAATGATTATTCTTGGGAAAGAGAAGATGCAAAGCGTATATGGTGCTTCGGTCCTCTA
GAAAAGGAGTCCACTAATTGCATCGTAAACCAAACAGTTGGTATATAAGGTATGCCTGCA
ATTCAGCCTTCTATAATAACCGCCTTCGAATGGTGTACTAAGGAAGGTCTTTTGTGTGAT
GAGCCTCTTAGAAATATTCGCTTTAACATAATGGATGTAATAATACACGATGAACCTGCT
CATCACAGAAGCAATCAAATAACCCCAGCAGCTAGAAGGCTATTTAAGGCTTGCTAATAT
GTGAGTGAACCTAAAATTTTGGAACCATTTTATTTATGCAACATTAAAACTCCAGATGAA
AGGAAAGGACCTATATATGCATTCCTCAATAAATTCCTAGATAAGAGAAGAGGTTTAGTT
TTAGGAGAAGAATATGATGATATATTTACCGTGATTCAAGCCTACATCCCTGTATCTGAA
AGCTTTGGATTCGACCAAGCTATAAAGTCAGTCTCCTAAGGTATGGCAATGCCAGCTCTC
TCATTCAGTCACTGGCAAGCAGTCTAGGGTAATCCACTCGACCCAGAATCAGAATCAGGT
AAGATTGTTAATGAAATAAGAATAAGAAAAGGTTTGAATGCTAAAATACCAGAACTCAAC
TATTATCTTGATAAACTTTGA


>TTHERM_00961880(gene)
ATGAAGACTCTCCAGATTGAGAAGATAAGAGAACTCATGATGAACCCCAATCAAATCAGA
AATATGTCTGTCATAGCCCACGTTGATCATGGTAAGACTACTTTAACTGATTCTTTGTTA
GCTAGAGCTGGTATCATCTCAGAAAGCAACGCTGGTAAAGCCTGCATGATGGATACTGAC
CCAAAAGAACAAAAAATGGGAATCACCATTAAGTCAACTGGAGTTTCCTTATACTATCAA
AATACTGTGACCAAGTAGGAGAGTATCATTAATTTGATTGATTCTCCAGGTCATATTGAC
TTTTCTGGTGAAGTTACTGCTGCATTAAGAGTTACTGATGGAGCTCTTGTTGTGGTAGAT
GCTGTTGAAGGTGTTGCTGTTCAAACAGAAACAGTTCTAAGGCAGGCTTGCCAAGAACGA
ATACGACCCGTTCTTGTAATTAATAAGCTAGACAGACTATTTAGTGAGCTTAAGGATGAT
TATGAAAATATTTATCAAAGATTAGTAGAGATCATAGCAAGGATTAATTCTATCTTGGAA
ATGAACGAAAATGAATCTATTAAAGGCTACACTTTAGATCCCTCACTTGGAAATGTTGCT
TTCTCTTCTGGTAAACAGTGCTGGGGATTCACTTTAAAGACTTTTGCTAGAATTTATAGT
CAAAAATTCTCAACAAAGGAAGAAACTTTAATGACTAAATTATGGGGAGACAACTATTTT
AATCCTCAAACAAAGTAATTCACCTCAGAATTAATCAGTAATAATACCTAAAACAAGTAA
GCTAGTCGTTCATTCATTGAATTCGTTTTAGTTCCTTTAGATAAGTACTATTCAGCCTCT
TCAAATGCAGAAATTGAAACTCTTTCCAAGATGGTTGAAAAGCTCAACCTTTCTTCCATT
CTAACTTCAGCTGAATTAGAAAGACTCAAATAGGTTGATGTTCAAGAGAGAATCAAGAGG
TCTATGAGGGCTTGGTTACCCTTAGCCGATGCCATACTTGAAATGGTCTAAGATCATTTA
CCTTCACCAAAAGAGGCTATGAAATATCGTAGTTTGTATCTTTACGAAGGACCTGCTGGT
GATGAGGCTTGTGCAGCAATGAGAGAATGTAATTCTGAGGGACCTCTCATGGTTTACATT
TCAAAAATGGTTTAAACTGAAGATCTTGGTAGATTTTATGCTTTTGGTAGAGTATTCAGT
GGCACAATATCTCAAGGCATGAAAGTCAGAGTCTAAGGTCCTGACTATAAACCTGGAAGC
AAAGAAGATCTCTTTATCAAAACAATCTAGCATACATTTTTGATGATGGGTAAACAGCAT
GAGCCTATCGAATCAGTACCAGCTGGAGGTACCGTCCTCATCTTAGGTGTTGATAACGCT
CTTACTAAAACAGGAACTCTTACAACTTCAGAAACAGCACATAATATCAGAAACATGAAG
TACACGATTTCACCTATATTGAGAGTTGCTGTCAATACTCCTAACTAACAAGATCTTACA
CGTCTACTTGAAGGTCTTAAGATGCTTCAAAAATATGATCCTCTTGTTCAAGTAGAAGTT
GAAGAAAATACAGGATCCTATGTTGTTGCTGGTAGTGGTGAATTGCATATTAAAATTTGC
TTAGAAAAACTGAATGATTTCACCCACAACTCTATTAATATTGTTGCTTCTCAACCCACT
GTATCTTACAGAGAAACAATAGCTGAAAAGAGCTCTTAAACTTGCCTAGCTAAGACTGAA
AATAAGCTTAATCATCTGTATGGTACTTGCGAACCACTTGATGAAGAATTAGGATCAGCA
ATAGTGAGCAAAAAAATAAATATTAAAGACATTAACAACTAAAAAATGATTAACAGTTTG
GTGAATGATTATTCTTGGGAAAGAGAAGATGCAAAGCGTATATGGTGCTTCGGTCCTCTA
GAAAAGGAGTCCACTAATTGCATCGTAAACCAAACAGTTGGTATATAAGGTATGCCTGCA
ATTCAGCCTTCTATAATAACCGCCTTCGAATGGTGTACTAAGGAAGGTCTTTTGTGTGAT
GAGCCTCTTAGAAATATTCGCTTTAACATAATGGATGTAATAATACACGATGAACCTGCT
CATCACAGAAGCAATCAAATAACCCCAGCAGCTAGAAGGCTATTTAAGGCTTGCTAATAT
GTGAGTGAACCTAAAATTTTGGAACCATTTTATTTATGCAACATTAAAACTCCAGATGAA
AGGAAAGGACCTATATATGCATTCCTCAATAAATTCCTAGATAAGAGAAGAGGTTTAGTT
TTAGGAGAAGAATATGATGATATATTTACCGTGATTCAAGCCTACATCCCTGTATCTGAA
AGCTTTGGATTCGACCAAGCTATAAAGTCAGTCTCCTAAGGTATGGCAATGCCAGCTCTC
TCATTCAGTCACTGGCAAGCAGTCTAGGGTAATCCACTCGACCCAGAATCAGAATCAGGT
AAGATTGTTAATGAAATAAGAATAAGAAAAGGTTTGAATGCTAAAATACCAGAACTCAAC
TATTATCTTGATAAACTTTGA


>TTHERM_00961880(protein)
MKTLQIEKIRELMMNPNQIRNMSVIAHVDHGKTTLTDSLLARAGIISESNAGKACMMDTD
PKEQKMGITIKSTGVSLYYQNTVTKQESIINLIDSPGHIDFSGEVTAALRVTDGALVVVD
AVEGVAVQTETVLRQACQERIRPVLVINKLDRLFSELKDDYENIYQRLVEIIARINSILE
MNENESIKGYTLDPSLGNVAFSSGKQCWGFTLKTFARIYSQKFSTKEETLMTKLWGDNYF
NPQTKQFTSELISNNTQNKQASRSFIEFVLVPLDKYYSASSNAEIETLSKMVEKLNLSSI
LTSAELERLKQVDVQERIKRSMRAWLPLADAILEMVQDHLPSPKEAMKYRSLYLYEGPAG
DEACAAMRECNSEGPLMVYISKMVQTEDLGRFYAFGRVFSGTISQGMKVRVQGPDYKPGS
KEDLFIKTIQHTFLMMGKQHEPIESVPAGGTVLILGVDNALTKTGTLTTSETAHNIRNMK
YTISPILRVAVNTPNQQDLTRLLEGLKMLQKYDPLVQVEVEENTGSYVVAGSGELHIKIC
LEKLNDFTHNSINIVASQPTVSYRETIAEKSSQTCLAKTENKLNHLYGTCEPLDEELGSA
IVSKKINIKDINNQKMINSLVNDYSWEREDAKRIWCFGPLEKESTNCIVNQTVGIQGMPA
IQPSIITAFEWCTKEGLLCDEPLRNIRFNIMDVIIHDEPAHHRSNQITPAARRLFKACQY
VSEPKILEPFYLCNIKTPDERKGPIYAFLNKFLDKRRGLVLGEEYDDIFTVIQAYIPVSE
SFGFDQAIKSVSQGMAMPALSFSHWQAVQGNPLDPESESGKIVNEIRIRKGLNAKIPELN
YYLDKL