Identifiers and Description

Gene Model Identifier

TTHERM_00971780

Standard Name

NTP3 (Nucleoside transporter 3)

Aliases

PreTt01448 | 180.m00068 | 3749.m00266

Description

NTP3 equilibrative nucleoside transporter family protein; Nucleoside transporter family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Vegetative Cell Cycle (Zhang et al., 2023)

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20013.1 9.997093137033517e-262
Description: nucleoside transporter (493 aa)
Oxytricha Contig18964.0.g30 2.000470901975128e-28
Description: Nucleoside transporter
DictyBase DDB_G0283439 0.000030009396760408108
Description: DDB_G0283439 on chromosome: 4 position 699253 to 700845

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00971780(coding)
ATGGGTATATCACCCGAATCTTCGGAGTAAAATAAAACTTCAATGACATTTATGGATAAA
AAACAAGAACTTTAAGATAGCTAAAAGAGAATATTGAATGATAATAAGAAAGTTAAATTT
GATGATTCAAATAAACAAATTATAGAGCTAAATAAATTACTTGATAGATTAAATCCTCAA
CTAAAAGGCTGGCATAGATTAGCTTTTGTCTTGCTTGGCATAGCATCACTAGCTGGTTGG
AATGCAATATTATCTGCTATTGATTTTTTCTAAGCGTAATATCCCAAGGATAAATTTATG
GATGTATCATTTTATTTTCCTGTTCCAATTATGTTAGCAAACTGCTTAGCAGCTTTCGTT
TGCCCAGCTTTAGCGCGTTTCTTTTCATTAAATTAAAGAATAGCATATACGCTTATGGGT
ACTTGCTTAACTATGGTTTCAGTCACTATGATTGCAATTTTCTTCAATACTCAAATGGGA
TTTTGGATTTCCTTTGTGATACTTATCATTTAAGGATTTATTGATTGTGTTAATACAAGT
TCATTGATATCTCTATCAGGGATGGTAGACTCAACGCTTAATAACACTTACTGGACTTGT
ACTGCTTTCTCAGGTTTAACTACAAATTTTTTGAGAATGATTACTCTTGCTTGGTTTGGT
GATGGGTAATCAGCAATTAATACAGGTTCAGCTCTTTACTTTTCAATAGCTGCTTTCGTA
TACGTAGTATCAAGTACACTCTAAGTTCTATTTGCTGATAGTGAATACTTCCACATAATA
TTGAAGAGACAGAAAGTGTATTCTAAAATAGAAGAAATTAAAAGAATATAAGCCATAAAT
AGTGATTTGTAATAATAAACAACTGCACATAATATTTCTTAAATATATGATTAATAAACA
CAAAAAATAAAAATTCTATATACAATAAAGCAAAATCCTATCATTAATTACTTCTTAGAG
ATAAAGCAAGTTTTTAAATACGCTGGCGCCATTCCTGTTTTTATAACTATTATTTACATA
CAGACCTTTATGGTATTCCCTGGAGTTTCAATCTTTTAAAAAAAACCATATCATATTGTC
GGCTAGACTTGGGCACAAGTTGTTATGATAACTATTTTTAACTTAGGAGATGTCGTCGGA
AAGTTTTCTGGATTTTACAAATCCTTACACAAACTTTATTTTGTTTACTCTGTAGTTCTT
TTAAGATTTATTTTCTTCTCTTTCTTTATAATAACTGCTAAGAGATAGGATCTAGAATTT
TTCTAGAACGATTTCTTTGCAATGATTAACATGTTTCTATTTGCCTTAGCAAATGGATTT
GGAACAACAGCTCTAATGAATCTAGGAACAAAAAACACTAGTGACCCTAAAATTACAGAT
CTCATCAATTATTATGGTGGATTTGCCATAGCTTTTGGAATCATGATAGGAACATTTTTA
TCTCTTCCCCTAAACTCATTTGTTGATTCTTCTTGA


>TTHERM_00971780(gene)
ATGGGTATATCACCCGAATCTTCGGAGTAAAATAAAACTTCAATGACATTTATGGATAAA
AAACAAGAACTTTAAGATAGCTAAAAGAGAATATTGAATGATAATAAGAAAGTTAAATTT
GATGATTCAAATAAACAAATTATAGAGCTAAATAAATTACTTGATAGATTAAATCCTCAA
CTAAAAGGCTGGCATAGATTAGCTTTTGTCTTGCTTGGCATAGCATCACTAGCTGGTTGG
AATGCAATATTATCTGCTATTGATTTTTTCTAAGCGTAATATCCCAAGGATAAATTTATG
GATGTATCATTTTATTTTCCTGTTCCAATTATGTTAGCAAACTGCTTAGCAGCTTTCGTT
TGCCCAGCTTTAGCGCGTTTCTTTTCATTAAATTAAAGAATAGCATATACGCTTATGGGT
ACTTGCTTAACTATGGTTTCAGTCACTATGATTGCAATTTTCTTCAATACTCAAATGGGA
TTTTGGATTTCCTTTGTGATACTTATCATTTAAGGATTTATTGATTGTGTTAATACAAGT
TCATTGATATCTCTATCAGGGATGGTAGACTCAACGCTTAATAACACTTACTGGACTTGT
ACTGCTTTCTCAGGTTTAACTACAAATTTTTTGAGAATGATTACTCTTGCTTGGTTTGGT
GATGGGTAATCAGCAATTAATACAGGTTCAGCTCTTTACTTTTCAATAGCTGCTTTCGTA
TACGTAGTATCAAGTACACTCTAAGTTCTATTTGCTGATAGTGAATACTTCCACATAATA
TTGAAGAGACAGAAAGTGTATTCTAAAATAGAAGAAATTAAAAGAATATAAGCCATAAAT
AGTGATTTGTAATAATAAACAACTGCACATAATATTTCTTAAATATATGATTAATAAACA
CAAAAAATAAAAATTCTATATACAATAAAGCAAAATCCTATCATTAATTACTTCTTAGAG
ATAAAGCAAGTTTTTAAATACGCTGGCGCCATTCCTGTTTTTATAACTATTATTTACATA
CAGACCTTTATGGTATTCCCTGGAGTTTCAATCTTTTAAAAAAAACCATATCATATTGTC
GGCTAGACTTGGGCACAGTAAAATTTATTTCTATTTATTTTAATTAAAAAGTAAAGGCAT
ACATACAGACTACTAAAAAAAATACACTTTTCGACTTATTAAATTTGTATTTTTAATCAA
ATTAATTATAATTTTTTAATAAAAATAGAGTTGTTATGATAACTATTTTTAACTTAGGAG
ATGTCGTCGGAAAGTTTTCTGGATTTTACAAATCCTTACACAAACTTTATTTTGTTTACT
CTGTAGTTCTTTTAAGATTTATTTTCTTCTCTTTCTTTATAATAACTGCTAAGAGATAGG
ATCTAGAATTTTTCTAGAACGATTTCTTTGCAATGATTAACATGTTTCTATTTGCCTTAG
CAAATGGATTTGGAACAACAGCTCTAATGAATCTAGGAACAAAAAACACTAGTGACCCTA
AAATTACAGATCTCATCAATTATTATGGTGGATTTGCCATAGCTTTTGGAATCATGATAG
GAACATTTTTATCTCTTCCCCTAAACTCATTTGTTGATTCTTCTTGA


>TTHERM_00971780(protein)
MGISPESSEQNKTSMTFMDKKQELQDSQKRILNDNKKVKFDDSNKQIIELNKLLDRLNPQ
LKGWHRLAFVLLGIASLAGWNAILSAIDFFQAQYPKDKFMDVSFYFPVPIMLANCLAAFV
CPALARFFSLNQRIAYTLMGTCLTMVSVTMIAIFFNTQMGFWISFVILIIQGFIDCVNTS
SLISLSGMVDSTLNNTYWTCTAFSGLTTNFLRMITLAWFGDGQSAINTGSALYFSIAAFV
YVVSSTLQVLFADSEYFHIILKRQKVYSKIEEIKRIQAINSDLQQQTTAHNISQIYDQQT
QKIKILYTIKQNPIINYFLEIKQVFKYAGAIPVFITIIYIQTFMVFPGVSIFQKKPYHIV
GQTWAQVVMITIFNLGDVVGKFSGFYKSLHKLYFVYSVVLLRFIFFSFFIITAKRQDLEF
FQNDFFAMINMFLFALANGFGTTALMNLGTKNTSDPKITDLINYYGGFAIAFGIMIGTFL
SLPLNSFVDSS