Identifiers and Description

Gene Model Identifier

TTHERM_00971840

Standard Name

LC8E (Light chain subunit of dynein )

Aliases

PreTt01454 | 180.m00074 | 3749.m00272 | LC8F

Description

LC8E cytoplasmic dynein light chain 2; Light chain subunit of dynein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20007.1 5.002115178225629e-63
Description: dynein light chain type 1 family protein (94 aa)
WormBase WBGene00001005 4.998021988471165e-24
Description: locus:dlc-1 Dynein light chain 1, cytoplasmic status:Confirmed UniProt:Q22799 protein_id:CCD63216.1
Oxytricha Contig20780.0.g106 1.9994498063102785e-22
Description: Dynein light chain type 1
DictyBase DDB_G0274815 1.000361553249356e-16
Description: dlcB on chromosome: 2 position 3974977 to 3975525
SGD YDR424C 1.000361553249356e-16
Description: DYN2 Cytoplasmic light chain dynein, microtubule motor protein; proposed to be involved in the assembly of the nuclear pore complex

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00971840(coding)
ATGGGAGATCATGCAAACGAATAAATTATTGACATGCCTGAAAATTCAGAAATGAAAAGC
ATGAAAAATGATGCCTTTTCTTAAGCTAAATTCGCAGTTGAAAATTATAAATTTGAAAAT
AAAATATCATCTCATATAAAGAAATTCTTTGATGAGAAGTATGGACCAAATTGGCATTGT
GTTGTTGGTAAGCACTTCAATGCTTATGTATCATATGATAGCAAAAACTTTATATTCTTT
TACGAGGGTTAATTAGCTATTCTTTTATATAGAAAAGGTTGA


>TTHERM_00971840(gene)
ATGGGAGATCATGCAAACGAATAAATTATTGACATGCCTGAAAATTCAGAAATGAAAAGC
ATGAAAAATGATGCCTTTTCTTAAGTAAATAGCTAAATGATTGATAAAAATAAATAAATT
TCATTTTTAAAAGGATTTAATATTGTTTAGATTAATTTTATTAGCCATCTTTAACTCAAG
AGTAGTCATTTAAACTAATATATTTTATAATAAAAAGGCTAAATTCGCAGTTGAAAATTA
TAAATTTGAAAATAAAATATCATCTCATATAAAGAAATTCTTTGATGAGAAGTATGGACC
AAATTGGCATTGTGTTGTTGGTAAAATAGCTTAGCTTAAAATTAAAAATAGGTTTTTTGA
AATTAATAATTTTTTTTTAATATAAAGGTAAGCACTTCAATGCTTATGTATCATATGATA
GCAAAAACTTTATATTCTTTTACGAGGGTTAATTAGCTATTCTTTTATATAGAAAAGGTT
GA


>TTHERM_00971840(protein)
MGDHANEQIIDMPENSEMKSMKNDAFSQAKFAVENYKFENKISSHIKKFFDEKYGPNWHC
VVGKHFNAYVSYDSKNFIFFYEGQLAILLYRKG