Identifiers and Description

Gene Model Identifier

TTHERM_00979910

Standard Name

LSF1 (Fusion of leishmanolysin-like peptidase and subtilisin-like proprotein convertase)

Aliases

PreTt08290 | 183.m00040

Description

LSF1 leishmanolysin family protein; Fusion of leishmanolysin-like peptidase and subtilisin-like proprotein convertase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00008 ) EGF-like domain
  • ( PF00053 ) Laminin EGF-like (Domains III and
  • ( PF00066 ) Notch (DSL) domain
  • ( PF00220 ) Neurohypophysial hormones, N-terminal Domain
  • ( PF00757 ) Furin-like cysteine rich region
  • ( PF01457 ) Leishmanolysin
  • ( PF02363 ) Cysteine rich repeat
  • ( PF02420 ) Insect antifreeze protein repeat
  • ( PF02822 ) Antistasin family
  • ( PF03107 ) DC1 domain
  • ( PF03302 ) Giardia variant-specific surface protein
  • ( PF07562 ) Nine Cysteines Domain of family
  • ( PF07699 ) GCC2 and GCC3
  • ( PF07974 ) EGF-like domain
  • ( PF08746 ) RING-like domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_10127.1 9.997093137033517e-262
Description: hypothetical protein (952 aa)
Stentor Coeruleus SteCoe_19005 5.0345753587649823e-45
Description: None
Oxytricha Contig18862.0.g77 9.00381557957642e-37
Description: hypothetical protein
DictyBase DDB_G0286533 9.997019043202629e-21
Description: DDB_G0286533 on chromosome: 4 position 4607142 to 4609511
WormBase WBGene00012796 9.99946582325553e-18
Description: Leishmanolysin-like peptidase status:Partially_confirmed UniProt:O62446 protein_id:CAB16471.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00979910(coding)
ATGATAAGTTAGAAGAACTTAACTTTTATCAATCTACTTTTTGTTGCCTTATTTTATCTA
AATAACTTCATAGTGAGTGCACACTCTGAATATGGTCATACTTGCGCTCATGATTCTGAT
GAAATGATCAGAAACACGTAAGAAAGGCTTCATGAATACTTTAAATAAAACCAGATCAAC
CATTCAGAAGAAGATGAATTAAAAAGAAATTTAGGCGCCTAGACTATTCAACCAATTAGA
ATAACAACTGATTTTTCCAGATTATCTCCATAACAAGGAGGACCAGCTATTTCTACAGCT
CAAATAAACTATTTGATTTCTGTCTCTACTACTGTTGTTAACTTTGTTTCTAATTTAATC
AAAGTTTAACCTAATACAAGTAATAATATTTTTAATACCTAATAAACCAACGATGGAACT
TGTATAACAGTAACTCCTTCATAAAGTGATAAAACAAATGGTATAGCTAATTCAGATCTA
CATTTATATTTCATTTTTAATAATGATCCAACTGCTGGGTATTTAGCAAATGCAGGATTT
TGCAATCTTTAGTAAACAGCTACATATTTTAGACCAAATTTCGGAAGAGTCTTATTTAAC
TTAGCTAATATGAAGAATACTGGTACTAATTTGGAGTAATACTAAAATGATGTTATGGTA
ACTTTGCATGAAGTTATTCACGTTCTTGGTTTTTCTTATGGAGCAATGTAAAACTGGTAT
GATAAAGCATCTAATTAATTATTAGGGTAAGCAGGAGCTAATAAATTAATTAGTACTCAA
ACTCTTAGAGGGATACAAACTAATATACTAGGATCTCCTAACGTTTTAGCTACAGCAAAA
AAATACTATGGATGTCCAAGCTTACAAGGAATGCAGTTGGAGAATCAAGGAGGATCAGGC
TCGATAAATTCACATTGGGAAAGAACAATCATCAGAAGTGAAGTAATGACAGCATCTGCT
CTTCTAGAAGGTTTAAATTTGACTTTCTTCACTGTAGCTCTTCTTAAAGATACTGGATAT
TGGGATGATGTTAATGAAAATTTAACTGACCCTATCTATTGGGGAAGAAATAAAGGTTGT
GATTTCTTTCAAAATGCGTGCAAAAGCTCTACTCAATATGAAGAATTTGCTACGGCAAAT
CAAAAATCTTGCTCGTTTTGGGGAGATGGATAAGGAATAGGTTCAATTTCTGATCCTTTT
GGTGATAGTTGTAGTGTTATTGAGGTCTATAGCAATCGTCTATGCAGTGATATAGCTAAT
TAAAGCTATTAGACTAATCCTCCTTCATTTAACACAGATACTTAAAATGATTTTTCTTAC
AATTCTAAATGTTTCACTTCAAATGTTTACAGCCCATCTGCTGTATACCATTACTAAAAT
GAAGATTTTAGGTGCCATTTTTATTAATGCACACCTGATAAAACATAAGTTACTATTACT
TTCTCACAAATACCAAATACAAAAATAGTTTGCGGAACTAGTGACTAAGGCAATCAAAAG
AATGTGGTCTATAACGGAAATACCTTAGGTTAAGTAACATGCCCATCAAATATTTCAAGA
TTATGCGATGACTAATAATGTGTTAACTTTTGCAGTTATAATGGTATTTGCATAAAAGGA
TAATGTTTATGTAATCCTGGTTATGGAGGCGTAGATTGCAGCTAAAAATGCTCTTAGTTT
ATTGATTAGAGTGGAAATTGCTTGATCTAATGTCCTAGTAATACTTACGCTAATTTAGAT
AAAGTTTGCAGATCTACCTGCCCCATAGGTACTTATCCTGATAACAACAGTGGCTTATGT
TAATAATGTGACTTTTCTTGTTCTTAATGTTCAGGTCCAAGTAACAATTAATGTAAAGCT
TGTTAATTTTTAACTTACTTATATTCTGGTACTTGCGTAACCTCCTGCCCATCTGGAACT
TACCCTGATGAACCTTCAAAAAGTTGTTTATCATGTTCGAATGGATGTTAGATATGTACT
AGTTCTACAACTTGTAGTTAGTGTAAAACTGGATTTTAATTATCTGGTTAAATGTGTACT
GCTATTTCATAATGCACTAGTCCATGTGCTTAATGTAGCTCTGACCCAAAATATTGTACA
TCATGTATAAATGGTCTTTTTCTTACATCTTAAAATACCTGCGTCTCTTCTTGCCCTACA
GGTTATTTCTAAAATAATCAAAATATGACTTGTGCTCCTTGTTCAACTGGATGTGCTTAG
TGCTCAGATGCTAATACATGCACTTAATGTGATACTTCCAAAGGATACAGAATTTAGGGA
AATGTATGCACTCTTTGTGTATCACCATGTGCCACATGCTCTAATTCTAATCCTAATTCT
TGCTTGTCTTGTGAAAATAAAATGTATTTAGTAAACAATTAATGTGTTTCTTCTTGTACA
AATGGATATTACAATGGACCAAATTATACTTGCTCTCAATGTATTAGTGGTTGCAGTTAA
TGTTCTGATGGAGTATCATGTACTTCATGTAGTAATAATTATAAACTATTCACTTAAAAT
AATGTTTAAATTTGTATCAGTTCATCTTCTTGCTTTTCTCCTTGCTCTACATGCGTTGGA
ACATTCCAACCAACCACTTGTGCATCATGTAACTAAGGATTTTATTTGCAAGCTAACTCT
TGTGTAACCTAATGTGATTAAGGTTATTTTTTAAATAATCAAATATGCACTTAATGCTCG
AATGGTTGTGCTAAATGCTCAAATTCAACTACCTGCACAGCATGTATAAATAATTATTTT
TTGCTACAAAATAATTGTGTTTAAACATGCCCTGATGGAACATATGCAGATCAAAGTTCA
AAAACTTGCTAAAACTGTCCTAACGGGTGCTCTAAATGCACTACTTCTACTATTTGTAGC
TAATGCCAAAATGGGTTTTAATTGTAAGGATAAAAATGTACATCTGCTTAGTGCACAAGT
CCTTGTGCTTCATGTACTTCTGATCCATCACATTGTACTACTTGTATAGGTGGTCTTTAT
ATCTCTCCATAAAATACATGTGTTTCTACATGTCCTTCAGGATATTTCTAAAATAATTCA
AATATGACTTGTACAGCATGTCCAACTGGTTGTATTAGTTGTTCCGATGCTAAGACTTGC
ATAAAATGTGATAGTACAAACGGATATAGGCTTTAAGGTAACTCTTGCACTCTTTGTGTA
TCTCCCTGTGCTACTTGCTCTTAAAATAATCCAAATTCTTGTTTAACTTGTGAAAATAGC
ATGTATTTTTTAAATAATAAATGTGTTTCTACTTGTACAAATGGATTTTACAATGGACCT
AATTACACCTGCTATTAGTGTATTACTGGATGCAGTTAATGCTCTGACAGTAATTCATGC
ATCTCTTGTGGTATTAATTATAAACTATTCACTTAAAATAATGCTAACATTTGTATCAGT
TCATCTTCATGCTTTTCTCCTTGCTCTACATGCGTTGGAACATTCCAACCAACTACTTGC
GCCACTTGTAACTAAGGATTTTATTTGCAAGGTAATTCTTGTGTAGCCTAATGTGATTAA
GGTTATTTTTTAGATTAATCTAATTAAAGATGTACTTAATGCTCTAGCGGTTGTGCTAAA
TGCTCAAATTCAACAAACTGCACATCATGTTCTAATAATTATTATTTGCAACAAAATAGC
TGCGTTTTAACATGTCCTGATGGTACATATGGTGATCAAACTTCAAAAACTTGCTAAAAC
TGTCCTAACGGATGTTCTAAATGTTCTAGTTCTACTATTTGTAGCTCATGCCAAAATGGG
TTTTAGTTGACAGGGTAAAAATGTACAGCTGTTTAATGTGTAACTCCATGTGCTTCATGT
AATTCTGATCCCACACAATGCACTTCTTGCATAGGTAGTCTTTATTTATCTCCTAAAAAT
ACATGTGTCTCTTCATGCCCTTCAGGATATTTCTAAAATAATTCAAATATGACTTGTACT
GCATGTCCATCTGGTTGTATTAGTTGTTCTGATGCTAAGACTTGCACAAAATGTGATAGT
CTAAATGGATATAGACTTTAAGGTAGTTCTTGTACTCTTTGTGTATCACCTTGCGCTACT
TGCTCTTAGATAAATCCTAATCTTTGTTTATCGTGTGAAAATAATATGTATTTATTAAAT
AATCAATGTGTCTCTACTTGTACAAATGGATTTTACAATGGTCCAAACTATACTTGCTCT
CCTTGCATTACTGGATGTAATTAATGCTTAGATGGAAATTCCTGTATTTCTTGTAGTGCC
AACTATCAGCTATTTGCATATAATAAGGTATAAATTTGCATTTCCTCATCTTCTTGCTTT
TCTCCTTGCTCTACATGTAAAGGTGCATTTTAGCCTACAACATGCTCTTCATGTAATTAA
AGCTTTTATTTACAAGGTTCTTCTTGTGTAGCTTAATGTAATTAAGGATATTTTGCCAAT
TAATCTAATTAGATGTGCACATAATGTCCTTCTAATTGTAGTGCTTGCTCTGGACCTACT
AGCTGCTCAGCTTGCTCTAATAATTATATCTTGTCTTAAAATAGCTGTGTTGCAGCATGT
CCACAAGGGTTTACAAACAAAAATTAAATTTGTACTTAAGTTAACATAAAAACTTAAGGT
TTTATATAATAGTTTGCAATACTATTTTTGGTTATATTGATAGTATCATCTTTTTGA


>TTHERM_00979910(gene)
ATGATAAGTTAGAAGAACTTAACTTTTATCAATCTACTTTTTGTTGCCTTATTTTATCTA
AATAACTTCATAGTGAGTGCACACTCTGAATATGGTCATACTTGCGCTCATGATTCTGAT
GAAATGATCAGAAACACGTAAGAAAGGCTTCATGAATACTTTAAATAAAACCAGATCAAC
CATTCAGAAGAAGATGAATTAAAAAGAAATTTAGGCGCCTAGACTATTCAACCAATTAGA
ATAACAACTGATTTTTCCAGATTATCTCCATAACAAGGAGGACCAGCTATTTCTACAGCT
CAAATAAACTATTTGATTTCTGTCTCTACTACTGTTGTTAACTTTGTTTCTAATTTAATC
AAAGTTTAACCTAATACAAGTAATAATATTTTTAATACCTAATAAACCAACGATGGAACT
TGTATAACAGTAACTCCTTCATAAAGTGATAAAACAAATGGTATAGCTAATTCAGATCTA
CATTTATATTTCATTTTTAATAATGATCCAACTGCTGGGTATTTAGCAAATGCAGGATTT
TGCAATCTTTAGTAAACAGCTACATATTTTAGACCAAATTTCGGAAGAGTCTTATTTAAC
TTAGCTAATATGAAGAATACTGGTACTAATTTGGAGTAATACTAAAATGATGTTATGGTA
ACTTTGCATGAAGTTATTCACGTTCTTGGTTTTTCTTATGGAGCAATGTAAAACTGGTAT
GATAAAGCATCTAATTAATTATTAGGGTAAGCAGGAGCTAATAAATTAATTAGTACTCAA
ACTCTTAGAGGGATACAAACTAATATACTAGGATCTCCTAACGTTTTAGCTACAGCAAAA
AAATACTATGGATGTCCAAGCTTACAAGGAATGCAGTTGGAGAATCAAGTAATATAATTC
ACTATCCTTAAAAATATTTAATTATCTACTTAATATTAATTAATTTTTCATTTATTTGAT
TTATTTAGGGAGGATCAGGCTCGATAAATTCACATTGGGAAAGAACAATCATCAGAAGTG
AAGTAATGACAGCATCTGCTCTTCTAGAAGGTTTAAATTTGACTTTCTTCACTGTAGCTC
TTCTTAAAGATACTGGATATTGGGATGATGTTAATGAAAATTTAACTGACCCTATCTATT
GGGGAAGAAATAAAGGTTGTGATTTCTTTCAAAATGCGTGCAAAAGCTCTACTCAATATG
AAGAATTTGCTACGGCAAATCAAAAATCTTGCTCGTTTTGGGGAGATGGATAAGGAATAG
GTTCAATTTCTGATCCTTTTGGTGATAGTTGTAGTGTTATTGAGGTCTATAGCAATCGTC
TATGCAGTGATATAGCTAATTAAAGCTATTAGACTAATCCTCCTTCATTTAACACAGATA
CTTAAAATGATTTTTCTTACAATTCTAAATGTTTCACTTCAAATGTTTACAGCCCATCTG
CTGTATACCATTACTAAAATGAAGATTTTAGGTGCCATTTTTATTAATGCACACCTGATA
AAACATAAGTTACTATTACTTTCTCACAAATACCAAATACAAAAATAGTTTGCGGAACTA
GTGACTAAGGCAATCAAAAGAATGTGGTCTATAACGGAAATACCTTAGGTTAAGTAACAT
GCCCATCAAATATTTCAAGATTATGCGATGACTAATAATGTGTTAACTTTTGCAGTTATA
ATGGTATTTGCATAAAAGGATAATGTTTATGTAATCCTGGTTATGGAGGCGTAGATTGCA
GCTAAAAATGCTCTTAGTTTATTGATTAGAGTGGAAATTGCTTGATCTAATGTCCTAGTA
ATACTTACGCTAATTTAGATAAAGTAAAAAATTTTTAATTTATTTAGATTTAATAATTTT
TCAAATGTAATTAAATATTACTATTAAAAATTTAGATAATTTTAGTTTTATTTTTTTGGT
TTTACTTTTGATCTATGACTTTTAGCAATAATAATATTCAAAAAATTAATTCCTTTAATT
TCAAATAAATTTTAGGTTTGCAGATCTACCTGCCCCATAGGTACTTATCCTGATAACAAC
AGTGGCTTATGTTAATAATGTGACTTTTCTTGTTCTTAATGTTCAGGTCCAAGTAACAAT
TAATGTAAAGCTTGTTAATTTTTAACTTACTTATATTCTGGTACTTGCGTAACCTCCTGC
CCATCTGGAACTTACCCTGATGAACCTTCAAAAAGTTGTTTATCATGTTCGAATGGATGT
TAGATATGTACTAGTTCTACAACTTGTAGTTAGTGTAAAACTGGATTTTAATTATCTGGT
TAAATGTGTACTGCTATTTCATAATGCACTAGTCCATGTGCTTAATGTAGCTCTGACCCA
AAATATTGTACATCATGTATAAATGGTCTTTTTCTTACATCTTAAAATACCTGCGTCTCT
TCTTGCCCTACAGGTTATTTCTAAAATAATCAAAATATGACTTGTGCTCCTTGTTCAACT
GGATGTGCTTAGTGCTCAGATGCTAATACATGCACTTAATGTGATACTTCCAAAGGATAC
AGAATTTAGGGAAATGTATGCACTCTTTGTGTATCACCATGTGCCACATGCTCTAATTCT
AATCCTAATTCTTGCTTGTCTTGTGAAAATAAAATGTATTTAGTAAACAATTAATGTGTT
TCTTCTTGTACAAATGGATATTACAATGGACCAAATTATACTTGCTCTCAATGTATTAGT
GGTTGCAGTTAATGTTCTGATGGAGTATCATGTACTTCATGTAGTAATAATTATAAACTA
TTCACTTAAAATAATGTTTAAATTTGTATCAGTTCATCTTCTTGCTTTTCTCCTTGCTCT
ACATGCGTTGGAACATTCCAACCAACCACTTGTGCATCATGTAACTAAGGATTTTATTTG
CAAGCTAACTCTTGTGTAACCTAATGTGATTAAGGTTATTTTTTAAATAATCAAATATGC
ACTTAATGCTCGAATGGTTGTGCTAAATGCTCAAATTCAACTACCTGCACAGCATGTATA
AATAATTATGTAATCATTTTTTCTTGATAAATTTAATTAATTATTTAAATAATAAAATTT
TCATAAAATATAATTTCATTATTATTTAATAAGTTTTTGCTACAAAATAATTGTGTTTAA
ACATGCCCTGATGGAACATATGCAGATCAAAGTTCAAAAACTTGCTAAAACTGTCCTAAC
GGGTGCTCTAAATGCACTACTTCTACTATTTGTAGCTAATGCCAAAATGGGTTTTAATTG
TAAGGATAAAAATGTACATCTGCTTAGTGCACAAGTCCTTGTGCTTCATGTACTTCTGAT
CCATCACATTGTACTACTTGTATAGGTGGTCTTTATATCTCTCCATAAAATACATGTGTT
TCTACATGTCCTTCAGGATATTTCTAAAATAATTCAAATATGACTTGTACAGCATGTCCA
ACTGGTTGTATTAGTTGTTCCGATGCTAAGACTTGCATAAAATGTGATAGTACAAACGGA
TATAGGCTTTAAGGTAACTCTTGCACTCTTTGTGTATCTCCCTGTGCTACTTGCTCTTAA
AATAATCCAAATTCTTGTTTAACTTGTGAAAATAGCATGTATTTTTTAAATAATAAATGT
GTTTCTACTTGTACAAATGGATTTTACAATGGACCTAATTACACCTGCTATTAGTGTATT
ACTGGATGCAGTTAATGCTCTGACAGTAATTCATGCATCTCTTGTGGTATTAATTATAAA
CTATTCACTTAAAATAATGCTAACATTTGTATCAGTTCATCTTCATGCTTTTCTCCTTGC
TCTACATGCGTTGGAACATTCCAACCAACTACTTGCGCCACTTGTAACTAAGGATTTTAT
TTGCAAGGTAATTCTTGTGTAGCCTAATGTGATTAAGGTTATTTTTTAGATTAATCTAAT
TAAAGATGTACTTAATGCTCTAGCGGTTGTGCTAAATGCTCAAATTCAACAAACTGCACA
TCATGTTCTAATAATTATGTAATTTTTTTCAAGATAAATATGTTTTTAAAAATTACAAAA
TATTTAAAAAATTTATAAAAATAAAAAGTATTTGCAACAAAATAGCTGCGTTTTAACATG
TCCTGATGGTACATATGGTGATCAAACTTCAAAAACTTGCTAAAACTGTCCTAACGGATG
TTCTAAATGTTCTAGTTCTACTATTTGTAGCTCATGCCAAAATGGGTTTTAGTTGACAGG
GTAAAAATGTACAGCTGTTTAATGTGTAACTCCATGTGCTTCATGTAATTCTGATCCCAC
ACAATGCACTTCTTGCATAGGTAGTCTTTATTTATCTCCTAAAAATACATGTGTCTCTTC
ATGCCCTTCAGGATATTTCTAAAATAATTCAAATATGACTTGTACTGCATGTCCATCTGG
TTGTATTAGTTGTTCTGATGCTAAGACTTGCACAAAATGTGATAGTCTAAATGGATATAG
ACTTTAAGGTAGTTCTTGTACTCTTTGTGTATCACCTTGCGCTACTTGCTCTTAGATAAA
TCCTAATCTTTGTTTATCGTGTGAAAATAATATGTATTTATTAAATAATCAATGTGTCTC
TACTTGTACAAATGGATTTTACAATGGTCCAAACTATACTTGCTCTCCTTGCATTACTGG
ATGTAATTAATGCTTAGATGGAAATTCCTGTATTTCTTGTAGTGCCAACTATCAGCTATT
TGCATATAATAAGGTATAAATTTGCATTTCCTCATCTTCTTGCTTTTCTCCTTGCTCTAC
ATGTAAAGGTGCATTTTAGCCTACAACATGCTCTTCATGTAATTAAAGCTTTTATTTACA
AGGTTCTTCTTGTGTAGCTTAATGTAATTAAGGATATTTTGCCAATTAATCTAATTAGAT
GTGCACATAATGTCCTTCTAATTGTAGTGCTTGCTCTGGACCTACTAGCTGCTCAGCTTG
CTCTAATAATTATGTAATAAAACTATTTTTTAAAATAAATTTAAATATTGTCTTTCCCTT
TTTATAATTAAATGCTAATATTAATTTTAAAATATAATAAATAGATCTTGTCTTAAAATA
GCTGTGTTGCAGCATGTCCACAAGGGTTTACAAACAAAAATTAAATTTGTACTTAAGTTA
ACATAAAAACTTAAGGTTTTATATAATAGTTTGCAATACTATTTTTGGTTATATTGATAG
TATCATCTTTTTGA


>TTHERM_00979910(protein)
MISQKNLTFINLLFVALFYLNNFIVSAHSEYGHTCAHDSDEMIRNTQERLHEYFKQNQIN
HSEEDELKRNLGAQTIQPIRITTDFSRLSPQQGGPAISTAQINYLISVSTTVVNFVSNLI
KVQPNTSNNIFNTQQTNDGTCITVTPSQSDKTNGIANSDLHLYFIFNNDPTAGYLANAGF
CNLQQTATYFRPNFGRVLFNLANMKNTGTNLEQYQNDVMVTLHEVIHVLGFSYGAMQNWY
DKASNQLLGQAGANKLISTQTLRGIQTNILGSPNVLATAKKYYGCPSLQGMQLENQGGSG
SINSHWERTIIRSEVMTASALLEGLNLTFFTVALLKDTGYWDDVNENLTDPIYWGRNKGC
DFFQNACKSSTQYEEFATANQKSCSFWGDGQGIGSISDPFGDSCSVIEVYSNRLCSDIAN
QSYQTNPPSFNTDTQNDFSYNSKCFTSNVYSPSAVYHYQNEDFRCHFYQCTPDKTQVTIT
FSQIPNTKIVCGTSDQGNQKNVVYNGNTLGQVTCPSNISRLCDDQQCVNFCSYNGICIKG
QCLCNPGYGGVDCSQKCSQFIDQSGNCLIQCPSNTYANLDKVCRSTCPIGTYPDNNSGLC
QQCDFSCSQCSGPSNNQCKACQFLTYLYSGTCVTSCPSGTYPDEPSKSCLSCSNGCQICT
SSTTCSQCKTGFQLSGQMCTAISQCTSPCAQCSSDPKYCTSCINGLFLTSQNTCVSSCPT
GYFQNNQNMTCAPCSTGCAQCSDANTCTQCDTSKGYRIQGNVCTLCVSPCATCSNSNPNS
CLSCENKMYLVNNQCVSSCTNGYYNGPNYTCSQCISGCSQCSDGVSCTSCSNNYKLFTQN
NVQICISSSSCFSPCSTCVGTFQPTTCASCNQGFYLQANSCVTQCDQGYFLNNQICTQCS
NGCAKCSNSTTCTACINNYFLLQNNCVQTCPDGTYADQSSKTCQNCPNGCSKCTTSTICS
QCQNGFQLQGQKCTSAQCTSPCASCTSDPSHCTTCIGGLYISPQNTCVSTCPSGYFQNNS
NMTCTACPTGCISCSDAKTCIKCDSTNGYRLQGNSCTLCVSPCATCSQNNPNSCLTCENS
MYFLNNKCVSTCTNGFYNGPNYTCYQCITGCSQCSDSNSCISCGINYKLFTQNNANICIS
SSSCFSPCSTCVGTFQPTTCATCNQGFYLQGNSCVAQCDQGYFLDQSNQRCTQCSSGCAK
CSNSTNCTSCSNNYYLQQNSCVLTCPDGTYGDQTSKTCQNCPNGCSKCSSSTICSSCQNG
FQLTGQKCTAVQCVTPCASCNSDPTQCTSCIGSLYLSPKNTCVSSCPSGYFQNNSNMTCT
ACPSGCISCSDAKTCTKCDSLNGYRLQGSSCTLCVSPCATCSQINPNLCLSCENNMYLLN
NQCVSTCTNGFYNGPNYTCSPCITGCNQCLDGNSCISCSANYQLFAYNKVQICISSSSCF
SPCSTCKGAFQPTTCSSCNQSFYLQGSSCVAQCNQGYFANQSNQMCTQCPSNCSACSGPT
SCSACSNNYILSQNSCVAACPQGFTNKNQICTQVNIKTQGFIQQFAILFLVILIVSSF