Identifiers and Description

Gene Model Identifier

TTHERM_00991620

Standard Name

DRH5 (DExD/H box RNA helicase 5)

Aliases

PreTt07854 | 185.m00075

Description

DRH5 DEAD/DEAH-box helicase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res
  • ( PF06519 ) TolA protein
  • ( PF08648 ) Protein of unknown function (DUF1777)
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( TIGR02794 ) protein TolA

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_02912.1 9.997093137033517e-262
Description: DEAD/DEAH box helicase (738 aa)
Oxytricha Contig7238.0.g67 9.997093137033517e-262
Description: DEAD/DEAH box helicase
WormBase WBGene00017162 2.0007442334946695e-153
Description: locus:ddx-23 status:Confirmed UniProt:Q95QN2 protein_id:CCD65989.1
DictyBase DDB_G0277857 4.000899569014317e-153
Description: helB2 on chromosome: 3 position 776296 to 778895
SGD YDR243C 4.001158060863534e-95
Description: PRP28 RNA helicase in the DEAD-box family, involved in RNA isomerization at the 5 splice site
Stentor Coeruleus SteCoe_8610 5.0345753587649823e-45
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00991620(coding)
ATGATCGAAGAGGAATATTTTAGCGAAGAAGAAGAAAATCAATAACAGCAATAAACTAAA
TAGCCGGAGGAAAATTCTTGGCGCCCTACACAAACAGAGACATAGGAAGAATAAACTAAT
GCTGCAGCTTTAGAAAGCGAACAACATGAATAAACAAATTAGAAGTAATAGATTCAATTA
GTCTACATGAGCAGAGCTGAAAGAGAGAAACTAAGATAAAAAGAGGAAGAAGATAGGAAA
AAGCGTGAATAGTAAAAGCTGAAATAGGAAAAGCAAATTAGAGAAGAATATGAAAAGTTT
AAATACAAAGAATGGAAGAGAGAATAGGAAAGGGAAGAAAGAAAGAGAGAAAGAGAATAA
AAAGAGAGGGAAGAAAAAGAAAAAAGAATGAGAGAAAAAAGCAAGTCTCGTTCTAGATCT
AGATCTGACAGTAGAGATAGAGATTCGAAGTATATGACTTCCAACACTAGAGCAACTGAA
AAAATAGCAATTATAAATTCTACTGAAGACCCAGAAATTCAAAATATTAAAATACAATAT
TTGGGTTTGAACAAAGAGAAAAAGAAGATTTTAAAGCCATCTGAAAAATTCAAAAATATA
TTTAATTTTAAATGGGATAGCAGTGACGATACTTCTGTCGATTTTAATCCTTTATACAAA
AATAAGATCCAGTCTAATTTCTTGTTTGGTAGAGGTATTTAAGCTGGTTATGATGTCAAA
GAGTAGCTAGAAAAGAATGTTAAGTATGAAGATTTGATCCACAAATTTGATCCTGAGTAC
TAGAAAAAGAAATAGGAAAATAAGGATAAAGATAAAGATAAAGATACAAAGAGAAGCATT
TACGATGTAACCACTAAAGACCATTGGTCATAGAAAAAATTTGATGAAATGACAGAAAGA
GATTGGCGTATTTTTAGAGAAGATAACGATATTATTATAAAGGGTGGCAGAGTTCCTAAG
CCTATGAGAACTTGGGAAGAAGGTGAACTCCCTCCTTACATATTAGATGCTGTCAGAAGA
TCAAAATATGAAAAACCAACTCCAATTTAAATGCAAACCATACCAATTGGTTTGTAAAGA
AAAGATCTGATTGGTATTTCCTAAACTGGTACAGGTAAAACTTGTGCTTTCCTCATACCT
TTAATTACATACTTGAGAAGTTTACCTCCGATGGATGAAGAAATAGCTAAAGATGGTCCT
TATGCTCTTATTTTAATTCCTACAAGAGAACTTGCTCCTTAAATCGAAAAAGAATTCTAA
AATTTGACTTCGAATATGAGAATGAAGAGTTTAGTTATGGTTGGTGGTAAGGATGAAGGA
AACCAAGCATTTAAGCTAAAATTGGGTTGTGAACTTCTTATCGGTACAGTAGGTAGAATT
AAAGATGCTCTTGAAAAAAATTATCTCGTTTTAGATTAAGTCTCTTGGGTAGTATTGGAT
GAAGCAGATAAAATGATTGATCTCAATTTTGAACAAGATGTCAACTTCATTTTAGATAAG
ATTCGCACAAATATGAAGAGTGAAGATGAAAATATGGCTGTTTTATAAGAGTAGGAAGCA
AAGGTTGGTGAAAAAATATTTAGAGTAACTCACTTGTTTAGTGCTACTATGCCTCCTAAT
TTAGAAAGACTTGCTAAAAAGTATTTAAGATCTTTTTGCTATATCAGTATTGGTGAAGCT
GGAGATGCCAAAAAGGATATTGAACAAATAGTTGATTTCATGTCAGAGGGTTAAAAGAAA
TCAAGACTTCAAAAAATTTTAGAAACGGCCAAACCTCCTATTATTATTTTTGCTAACGAA
AAGACAGCCGTAGAAAAGTTATCAAAGATTTTAGATAGATGGGGATGGTAAAATGTTATC
TATCATGGTGGTAAGACTCAATAATAAAGAGAAGCAGCTGTTGATGGATTCAAAAAAGGA
AAATATGATATTCTTGTTGCTACAGATCTTGGTGCTAGAGGTCTCCACGTTGATGGAGTT
AAGATGGTTATTAACTTTGATGCTCCCAAAAATATAAAAGATTTCATTCACAGAACAGGT
AGAACTGGTAGAGCAGGAAAACGTGGTATTGCTTACACATTCGTTACTAATCATAATGAA
GCAATTATGTATGATTTAAGAGAGTTCTTATTCAAAAATAATTTTGATATCCCTTCAGAA
CTCGATACTCACCCAGCTGCTCAAACAAAGCCAGGAACTATTTCTGAAAACGTTCCTCGT
AGTCAGTAAGTAATTTTAGCCTAGTAATGA


>TTHERM_00991620(gene)
ATGATCGAAGAGGAATATTTTAGCGAAGAAGAAGAAAATCAATAACAGCAATAAACTAAA
TAGCCGGAGGAAAATTCTTGGCGCCCTACACAAACAGAGACATAGGAAGAATAAACTAAT
GCTGCAGCTTTAGAAAGCGAACAACATGAATAAACAAATTAGAAGTAATAGATTCAATTA
GTCTACATGAGCAGAGCTGAAAGAGAGAAACTAAGATAAAAAGAGGAAGAAGATAGGAAA
AAGCGTGAATAGTAAAAGCTGAAATAGGAAAAGCAAATTAGAGAAGAATATGAAAAGTTT
AAATACAAAGAATGGAAGAGAGAATAGGAAAGGGAAGAAAGAAAGAGAGAAAGAGAATAA
AAAGAGAGGGAAGAAAAAGAAAAAAGAATGAGAGAAAAAAGCAAGTCTCGTTCTAGATCT
AGATCTGACAGTAGAGATAGAGATTCGAAGTATATGACTTCCAACACTAGAGCAACTGAA
AAAATAGCAATTATAAATTCTACTGAAGACCCAGAAATTCAAAATATTAAAATACAATAT
TTGGGTTTGAACAAAGAGAAAAAGAAGATTTTAAAGCCATCTGAAAAATTCAAAAATATA
TTTAATTTTAAATGGGATAGCAGTGACGATACTTCTGTCGATTTTAATCCTTTATACAAA
AATAAGATCCAGTCTAATTTCTTGTTTGGTAGAGGTATTTAAGCTGGTTATGATGTCAAA
GAGTAGCTAGAAAAGAATGTTAAGTATGAAGATTTGATCCACAAATTTGATCCTGAGTAC
TAGAAAAAGAAATAGGAAAATAAGGATAAAGATAAAGATAAAGATACAAAGAGAAGCATT
TACGATGTAACCACTAAAGACCATTGGTCATAGAAAAAATTTGATGAAATGACAGAAAGA
GATTGGCGTATTTTTAGAGAAGATAACGATATTATTATAAAGGGTGGCAGAGTTCCTAAG
CCTATGAGAACTTGGGAAGAAGGTGAACTCCCTCCTTACATATTAGATGCTGTCAGAAGA
TCAAAATATGAAAAACCAACTCCAATTTAAATGCAAACCATACCAATTGGTAATAAAATT
AATTTTATTTATTTAAAACAATTCGTTTAAATCATTTTTATTCAATCTTAAATTTTAATA
TTTAAATAAATAAATAAATAAATAAATAGGTTTGTAAAGAAAAGATCTGATTGGTATTTC
CTAAACTGGTACAGGTAAAACTTGTGCTTTCCTCATACCTTTAATTACATACTTGAGAAG
TTTACCTCCGATGGATGAAGAAATAGCTAAAGATGGTCCTTATGCTCTTATTTTAATTCC
TACAAGAGAACTTGCTCCTTAAATCGAAAAAGAATTCTAAAATTTGACTTCGAATATGAG
AATGAAGAGTTTAGTTATGGTTGGTGGTAAGGATGAAGGAAACCAAGCATTTAAGCTAAA
ATTGGGTTGTGAACTTCTTATCGGTACAGTAGGTAGAATTAAAGATGCTCTTGAAAAAAA
TTATCTCGTTTTAGATTAAGTCTCTTGGGTAGTATTGGATGAAGCAGATAAAATGATTGA
TCTCAATTTTGAACAAGATGTCAACTTCATTTTAGATAAGTAAAAAAAATTATTATTAAA
CAAATTTAATTAAATAAAAAAGTAAAATAACATTTTAATAAACTAATTTTATGAAGAAAT
AGCTTTTCTTTATTAATAAAGACTAGATTATTTTTAAATTAGATTAAATTTTTTTTAATT
TTAAATTAATTTTTATTTAAATTTAAGGATTCGCACAAATATGAAGAGTGAAGATGAAAA
TATGGCTGTTTTATAAGAGTAGGAAGCAAAGGTTGGTGAAAAAATATTTAGAGTAACTCA
CTTGTTTAGTGCTACTATGCCTCCTAATTTAGAAAGACTTGCTAAAAAGTATTTAAGATC
TTTTTGCTATATCAGTATTGGTGAAGCTGGAGATGCCAAAAAGGATATTGAACAAATAGT
TGATTTCATGTCAGAGGGTTAAAAGAAATCAAGACTTCAAAAAATTTTAGAAACGGCCAA
ACCTCCTATTATTATTTTTGCTAACGAAAAGACAGCCGTAGAAAAGTTATCAAAGATTTT
AGATAGATGGGGAGTAATAAATTATTTTAATTTATTTATTAGAATAAAAAATTCTTTAAA
CGCAGTATTTAAAGGTGGAATGTTGTGAAAACTAAATTGATGTCTACATTCAAAATAAAT
ACTGCTACATTTATCAAAAATTACTTTTAATTGACAATTATTAAGTTGATTAAAATTAAC
TTCAATTTTTAATGAATTAATTTGTTTATTTATTTTAGATATTTATTCTTATTTATTATT
AATTAAAAGTGGTAAAATGTTATCTATCATGGTGGTAAGACTCAATAATAAAGAGAAGCA
GCTGTTGATGGATTCAAAAAAGGAAAATATGATATTCTTGTTGCTACAGATCTTGGTGCT
AGAGGTCTCCACGTTGATGGAGTTAAGATGGTTATTAACTTTGATGCTCCCAAAAATATA
AAAGATTTCATTCACAGAACAGGTAGAACTGGTAGAGCAGGAAAACGTGGTATTGCTTAC
ACATTCGTTACTAATCATAATGAAGCAATTATGTATGATTTAAGAGAGTTCTTATTCAAA
AATAATTTTGATATCCCTTCAGAACTCGATACTCACCCAGCTGCTCAAACAAAGCCAGGA
ACTATTTCTGAAAACGTTCCTCGTAGTCAGTAAGTAATTTTAGCCTAGTAATGA


>TTHERM_00991620(protein)
MIEEEYFSEEEENQQQQQTKQPEENSWRPTQTETQEEQTNAAALESEQHEQTNQKQQIQL
VYMSRAEREKLRQKEEEDRKKREQQKLKQEKQIREEYEKFKYKEWKREQEREERKREREQ
KEREEKEKRMREKSKSRSRSRSDSRDRDSKYMTSNTRATEKIAIINSTEDPEIQNIKIQY
LGLNKEKKKILKPSEKFKNIFNFKWDSSDDTSVDFNPLYKNKIQSNFLFGRGIQAGYDVK
EQLEKNVKYEDLIHKFDPEYQKKKQENKDKDKDKDTKRSIYDVTTKDHWSQKKFDEMTER
DWRIFREDNDIIIKGGRVPKPMRTWEEGELPPYILDAVRRSKYEKPTPIQMQTIPIGLQR
KDLIGISQTGTGKTCAFLIPLITYLRSLPPMDEEIAKDGPYALILIPTRELAPQIEKEFQ
NLTSNMRMKSLVMVGGKDEGNQAFKLKLGCELLIGTVGRIKDALEKNYLVLDQVSWVVLD
EADKMIDLNFEQDVNFILDKIRTNMKSEDENMAVLQEQEAKVGEKIFRVTHLFSATMPPN
LERLAKKYLRSFCYISIGEAGDAKKDIEQIVDFMSEGQKKSRLQKILETAKPPIIIFANE
KTAVEKLSKILDRWGWQNVIYHGGKTQQQREAAVDGFKKGKYDILVATDLGARGLHVDGV
KMVINFDAPKNIKDFIHRTGRTGRAGKRGIAYTFVTNHNEAIMYDLREFLFKNNFDIPSE
LDTHPAAQTKPGTISENVPRSQQVILAQQ