Identifiers and Description

Gene Model Identifier

TTHERM_00992960

Standard Name

PLK1 (Polo-Like Kinase)

Aliases

PreTt18357 | 186.m00073

Description

PLK1 polo kinase; Polo-like kinase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04359.1 9.997093137033517e-262
Description: hypothetical protein (1099 aa)
Oxytricha Contig14897.0.1.g59 9.003513400998346e-160
Description: Protein kinase domain
DictyBase DDB_G0274503 2.0000857274312427e-108
Description: plk on chromosome: 2 position 4379150 to 4382891
SGD YMR001C 9.000169967702421e-91
Description: CDC5 Polo-like kinase with multiple functions in mitosis and cytokinesis through substrate phosphorylation, also functions in adaptation to DNA damage during meiosis; has similarity to Xenopus Plx1 and S. pombe Plo1p; possible Cdc28p substrate
WormBase WBGene00004042 9.996584278131743e-91
Description: locus:plk-1 Serine/threonine-protein kinase plk-1 status:Confirmed UniProt:P34331 protein_id:CCD64438.1
Stentor Coeruleus SteCoe_36041 5.96629836401057e-72
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00992960(coding)
ATGGCAAGTAATCGTAGAAGTTCAGCTGAGCCAGGCCACACTGAGAGCATGGTAATAGTA
GAAGAAGTTATTAAGGATTAAGGAGTAATCAGAAGATACTCAAAGGGTCGCTTTTTGGGA
AAAGGTGGTTTTGCAAAGTGCTATGAATTTACAAATTTAGAAAGAAAATAAGTATTAGCT
GCTAAGGTTATTCCTAAGAGCTCTTTAACTAAGAGCCGTGCTCGCTAAAAATTAATGAGC
GAAATAAGAATCCACAAGTCTTTAAACCATAGAAATATAGTGAAATTTTAACATTTTTTT
GAGGACTAAGAAAATGTCTACATATTGTTAGAGATGTGTACAAATCAGACAATGAATGAA
CTTATCAGGAGAAGAAAGAGATTGACTGAATTAGAAGTTTAATGCTATTTATTGCAGATT
CTTTATTCAATCAAATACTTACATGATAACAGAGTGATACATCGTGATCTCAAATTAGGA
AATTTATTTTTATCTGATAAGATGGAAATTAAACTAGGAGATTTTGGATTGGCTACAAAA
CTAGAATATGATGGAGAAAGAAAACGCACTATTTGCGGTACTCCTAATTATATAGCTCCT
GAAATTTTAGAAGCGAAAGAAACAGGTCACTCATATGAAGTCGACGTTTGGTCTTTCGGT
GTTATTGCATATACTTTACTAATAGGTAAACCACCTTTTGAAACAAACGACGTAAAATCT
ACCTACAAGAAAATCAGAACAAATGAATACTCCTTCCCAGAATAAATTCAAATTTCATCT
GCTGCCAAAAATATGATAAAAAAGATTCTCACGACTGATCCTTCGAAGAGACCCACTATT
AATGAATTATTTAATGACGATTTTTTCAAAACAGGTGGATCAATTCCTAAACTGCTACCT
GTAAGCACTCTTGCTTGCCCTCCAAGTGCCTCATATACTCGCTAATTCTTACCTTCAACA
CAAATTTCTTTATCTACCAATCAAAAATCTACAAATTATTAAGTAGAGAATAAGAATAGC
TCACCTAAAAAATTTGACAACACAACTCCTATTAATGGAAATGGTTTTACACGTTTTGCA
ACCCAAACTTCCTATAATCCTTAAAATGTAAAATCTTAATAGTAGATGGGTTTAAAAGAG
AGAAAAGACTATATTAATACTTACCGTACAGGTGGAGCTTAAACAAGTAGCAGTTCAGGT
TTATGTAATAGTTAGTATGGCTAAAAGAATTTTGATACTAATAACGTTAATAACTAAAAA
ATAGACAACTTTTTGTAAACAAATAAGAACACCTATGGGTTAAATGGAAGTGTAGCAAAA
GAATAATGCTTCCAAAAAAGTTCTAGTTTAAATCCATAAAGTGAAGGTACCACTATCACA
AATAATTTAAATTTGGGAATACTCAATTTTGCTAAAAGTCAAAGTACAAACACTTAATTA
GTCGAAAACAGTAACCTCAACAGTTAGAAAACAGATAATTATATTCAAAAAATGGATGAA
TGCAGCCAAAAAGCCTAGCCATAGGTACAAAATTCTAATTAACACAAATCAGAAGATTAT
AGTAAGAATAGTTGCTTAACAAATTAAAAATATACTTCTCAAGCTAGTCATCCTCAAAGT
TAAGCAGCTTTAAATTCTGTTTAAAGCCAAGCTAATATTAAGAATATTAATAATAGTACA
AGCATAGCTAATTTTGCTTATAATTAAAGTTCTGCCGCAATTAACTCAAATACTAATTTG
ATTTCTACTAACTTAAATAATCTCAGCGGAGGAGCTAGCTCTATCAGTAATCAGAATTAC
TTATCTCAAAATAAAAATTATCCTTCATAATAATCTACAAATGCAGTATTTAACAGAAAC
TCAATTGAAAAATATTCTAGCTCAAACAATATTAGATCTGGAAATTCTAACTATACTCGT
GCTAAATCTGAAAAAATGCATACATAACCTACTTCAAGTCTCCTTTAAGCATATGGTTTC
ACAAAAGTTGAATAAGCTCCTTCTAGTGGAACTACTGCCCTTAACTTTAATAATAGTGGC
TCTTACTTCTAAGCTCCAGTAAGCTCTAATGAAGTTCAAATCTAAGGTCCTGATATTTGG
GTTTCAAAATGGGTAGACTACTCTTCAAAATACGGTTTAGGCTATCTATTAAATAATGGC
TAAGCAGGTGTTTTCTTTAACGACTCAACTAAGATTATTCTTAATCCAAAAACAGAATAA
TTTGATTACATCGAGAGAAATTCTTCTTCCAAATAAGACTTTGGGGCAGAATATACACTT
AAGGATTATCCTGAATCTCTTTAAAAGAAATTGACTTTGTTATAGCATTTCCGTAGTTTT
TTAGAAGGAGAAGACAAGAAAGCAGATTCTATAAAAATGCCATAGAATGAGGCTAGTGGT
GAACCTAAATCTTCTAAAATATATGTTAAGAAATGGCTACGTACAAAAAATGCTATCCTT
TTCCGTTTGAGCAATAAAGTAGTTTAAGTTATTTTTTAGGACAGCTCTGAAATTATCTTG
AGTAGTGAGCTTCGTGCTGTAACTTATGTTAATAGGAAGAAATAAAGAGAAACCTTTCCT
CTTAGCACTGCTATGGAGTCATAAAACAAAGAAATGTCAAAGCGTCTTACATACACCAAA
GATATATTAACTCATATGCTTAGTGGTAATGTGTAAAGCAAAGGTGAACAATAGAATAAT
GAAAATATTTCTGTTTAAGATCCTACTTCTACTATTACTAATCCAATTGGATTAATAAAT
TAAAATTAAGATGGTAAAGAGAAAAACCATTCTAAGAACTAATCAATTAATCCAAATTCT
TGCTCTAGTGCAAGTCTTTACCCAACTGCAACTACAACTTAATATGCAAATAATAATAGT
TCTTCTTAAATTTAACCTTCTTAAAAGCCTTCGACTAGAGAGAATCTCCACTACTCTAAA
AATGTGCCACTCTCTTCTGTAACTAACTCTATATATATGCAAAATCAATAGTCTAATCCT
ATTTATAATAATTACACCTAGAATGAAAATGTTAATGTATTGCTACTTAACAAACAGCAG
AGCTTGTAAAATTAAAAGCCTTCAATTAATGGTTATGAGTTAAATGGATTCGCAAGTAGC
AATAGTGCAAACAAGAAGGAATCTTTAGCTACTAATTCTAATATTATAAATAGCACTGAA
GGTAAATGCCTTGGACAGCCTTCAAATATTTAAAACCTATTAAAGAGTAACTCTACTATT
GGTAGAATGAATTCTATGAATCCTACTGCTACCAGCTCTCTTTCTAATCTAAATAATTTT
AATAACTATGTAATGAGTTCACGTAAAACTGAAAATTGA


>TTHERM_00992960(gene)
ATGGCAAGTAATCGTAGAAGTTCAGCTGAGCCAGGTAAGCTACTAGCATTTATTATATAT
TTTTTCATTCAAAACTAATGCATATTTAATTTATATTTGCAAGGATTATTAGTTTACTTG
TTATTTAAAATTAAAATATTTTGAAAATTAGGCCACACTGAGAGCATGGTAATAGTAGAA
GAAGTTATTAAGGATTAAGGAGTAATCAGAAGATACTCAAAGGGTCGCTTTTTGGGAAAA
GTAAAGCATATATACTATCTATTAATTCAATATGATTCAACTTTAATCTAAATTACAGCT
TATAATTCCTTTGTTTAAATGTTTGTAAATTTTTACTATTAATAAATTCATAAAATAAAA
AGGGTGGTTTTGCAAAGTGCTATGAATTTACAAATTTAGAAAGAAAATAAGTATTAGCTG
CTAAGGTTATTCCTAAGAGCTCTTTAACTAAGAGCCGTGCTCGCTAAAAAGTGATAAATT
ATTTTATTTTATTGATAATTTACAAATCAGAATGAAATTTAGTAGGGATTGCTAGTCTAT
TTATGATCTATTAATACTTACCAATTAATTAAAATTACGTTGTTATTTCTTATTGAATTT
TGAAATTAAAAATCAAATAAACAGACAGAAACACAGAAAAAAACATTCTCATAAATAATA
AAGTCAATCAATCAATCAATCAAAATTAAATTGAATAGATCACTTGATTTATTTGATAGC
ATTAAATCATAGTTTATTCAAGCTAGCTTAGACTAAATTTTATATTCGCTTTAAAATAAT
ATTCCCAAACATTAAAAATTTCAATTCTTTTAAAATGATTTTGATTTTATGATATCTTTT
AATATTATTTTTTAATTTATAAAGTTAATGAGCGAAATAAGAATCCACAAGTCTTTAAAC
CATAGAAATATAGTGAAATTTTAACATTTTTTTGAGGACTAAGAAAATGTCTACATATTG
TTAGAGATGTGTACAAATCAGGTAAATGTTTACATTTCTCAATTTCATAATGATTATATG
AAAAAAATTATTTTTATTATTTCTTTTTACACAGGAAATATTTTTATTACTATTATTTTG
TATTTCAATTTCTTCAAATTTTTTAATATTAATTTTTGAATTTTACTACATCAATAAAAT
AATCAGTTAACAAACATAATTAAGTCTCAAGTTATTAAATTACACAATAGTGATAAAAGC
GCAAGAAAAAAAAAAAGAATTTATCTGATTTTCATTAAAAAATAAGAAAAAACTTGCTAA
ACACAGAAATAGTTTTTATTTTAAATTAGTCGAATTGTTTATAAAAAATAAACTAAGATA
GTTTATAAACGAATAATCAACTTATATATAAAAGAATATTTGAAGGATATTTATGAATCA
TTTAATCTATAAATTATAAAAAATGATTGAAATCAAACACAGTTGATTAATTAATTAACT
AATTATAATAATATGTATTAAAAGACAATGAATGAACTTATCAGGAGAAGAAAGAGATTG
ACTGAATTAGAAGTTTAATGCTATTTATTGCAGATTCTTTATTCAATCAAATACTTACAT
GATAACAGAGTGATACATCGTGATCTCAAATTAGGAAATTTATTTTTATCTGATAAGATG
GAAATTAAACTAGGAGATTTTGGATTGGCTACAAAACTAGAATATGATGGAGAAAGAAAA
CGCACTATTTGCGGTACTCCTAATTATATAGCTCCTGAAATTTTAGAAGCGAAAGAAACA
GGTCACTCATATGAAGTCGACGTTTGGTCTTTCGGTGTTATTGCATATACTTTACTAATA
GGTAAAAAGTATTTTATATAAAAAGCAAATTACAATTTTAATATTTAAAGATCAATCTTA
ATGTTTTTTTCAAGAGTTTTCAAATCTAAATTATGAAATATTTTTATTTATTAGGTAAAC
CACCTTTTGAAACAAACGACGTAAAATCTACCTACAAGAAAATCAGAACAAATGAATACT
CCTTCCCAGAATAAATTCAAATTTCATCTGCTGCCAAAAATATGATAAAAAAGATTCTCA
CGACTGATCCTTCGAAGAGACCCACTATTAATGAATTATTTAATGACGATTTTTTCAAAA
CAGGTGGATCAATTCCTAAACTGCTACCTGTAAGCACTCTTGCTTGCCCTCCAAGTGCCT
CATATACTCGCTAATTCTTACCTTCAACACAAATTTCTTTATCTACCAATCAAAAATCTA
CAAATTATTAAGTAGAGAATAAGAATAGCTCACCTAAAAAATTTGACAACACAACTCCTA
TTAATGGAAATGGTTTTACACGTTTTGCAACCCAAACTTCCTATAATCCTTAAAATGTAA
AATCTTAATAGTAGATGGGTTTAAAAGAGAGAAAAGACTATATTAATACTTACCGTACAG
GTGGAGCTTAAACAAGTAGCAGTTCAGGTTTATGTAATAGTTAGTATGGCTAAAAGAATT
TTGATACTAATAACGTTAATAACTAAAAAATAGACAACTTTTTGTAAACAAATAAGAACA
CCTATGGGTTAAATGGAAGTGTAGCAAAAGAATAATGCTTCCAAAAAAGTTCTAGTTTAA
ATCCATAAAGTGAAGGTACCACTATCACAAATAATTTAAATTTGGGAATACTCAATTTTG
CTAAAAGTCAAAGTACAAACACTTAATTAGTCGAAAACAGTAACCTCAACAGTTAGAAAA
CAGATAATTATATTCAAAAAATGGATGAATGCAGCCAAAAAGCCTAGCCATAGGTACAAA
ATTCTAATTAACACAAATCAGAAGATTATAGTAAGAATAGTTGCTTAACAAATTAAAAAT
ATACTTCTCAAGCTAGTCATCCTCAAAGTTAAGCAGCTTTAAATTCTGTTTAAAGCCAAG
CTAATATTAAGAATATTAATAATAGTACAAGCATAGCTAATTTTGCTTATAATTAAAGTT
CTGCCGCAATTAACTCAAATACTAATTTGATTTCTACTAACTTAAATAATCTCAGCGGAG
GAGCTAGCTCTATCAGTAATCAGAATTACTTATCTCAAAATAAAAATTATCCTTCATAAT
AATCTACAAATGCAGTATTTAACAGAAACTCAATTGAAAAATATTCTAGCTCAAACAATA
TTAGATCTGGAAATTCTAACTATACTCGTGCTAAATCTGAAAAAATGCATACATAACCTA
CTTCAAGTCTCCTTTAAGCATATGGTTTCACAAAAGTTGAATAAGCTCCTTCTAGTGGAA
CTACTGCCCTTAACTTTAATAATAGTGGCTCTTACTTCTAAGCTCCAGTAAGCTCTAATG
AAGTTCAAATCTAAGGTCCTGATATTTGGGTTTCAAAATGGGTAGACTACTCTTCAAAAT
ACGGTTTAGGCTATCTATTAAATAATGGCTAAGCAGGTGTTTTCTTTAACGACTCAACTA
AGATTATTCTTAATCCAAAAACAGAGTAATTAATTATTTTTTTTTTAAATAAATTTAAAT
TCATAGACTTACTTACATTTCCTTTTAAAATAAAGATAATTTGATTACATCGAGAGAAAT
TCTTCTTCCAAATAAGACTTTGGGGCAGAATATACACTTAAGGATTATCCTGAATCTCTT
TAAAAGAAATTGACTTTGTTATAGCATTTCCGTAGTTTTTTAGAAGGAGAAGACAAGAAA
GCAGATTCTATAAAAATGCCATAGAATGAGGCTAGTGGTGAACCTAAATCTTCTAAAATA
TATGTTAAGAAATGGCTACGTACAAAAAATGCTATCCTTTTCCGTTTGAGCAATAAAGTA
GTTTAAGTTATTTTTTAGGACAGCTCTGAAATTATCTTGAGTAGTGAGCTTCGTGCTGTA
ACTTATGTTAATAGGAAGAAATAAAGAGAAACCTTTCCTCTTAGCACTGCTATGGAGTCA
TAAAACAAAGAAATGTCAAAGCGTCTTACATACACCAAAGATATATTAACTCATATGCTT
AGTGGTAATGTGTAAAGCAAAGGTGAACAATAGAATAATGAAAATATTTCTGTTTAAGAT
CCTACTTCTACTATTACTAATCCAATTGGATTAATAAATTAAAATTAAGATGGTAAAGAG
AAAAACCATTCTAAGAACTAATCAATTAATCCAAATTCTTGCTCTAGTGCAAGTCTTTAC
CCAACTGCAACTACAACTTAATATGCAAATAATAATAGTTCTTCTTAAATTTAACCTTCT
TAAAAGCCTTCGACTAGAGAGAATCTCCACTACTCTAAAAATGTGCCACTCTCTTCTGTA
ACTAACTCTATATATATGCAAAATCAATAGTCTAATCCTATTTATAATAATTACACCTAG
AGTAAATAAATTAAAAACTATAAATAAAATAAATTTTTAACAAATTTTGTATTTTAAATA
GATGAAAATGTTAATGTATTGCTACTTAACAAACAGCAGAGCTTGTAAAATTAAAAGCCT
TCAATTAATGGTAATTCTTTATACAATAAAATTTCTAACTTATTTTAAATTTAATTAATT
TAGGTTATGAGTTAAATGGATTCGCAAGTAGCAATAGTGCAAACAAGAAGGAATCTTTAG
CTACTAATTCTAATATTATAAATAGCACTGAAGGTAAATGCCTTGGACAGCCTTCAAATA
TTTAAAACCTATTAAAGAGTAACTCTACTATTGGTAGAATGAATTCTATGAATCCTACTG
CTACCAGCTCTCTTTCTAATCTAAATAATTTTAATAACTATGTAATGAGTTCACGTAAAA
CTGAAAATTGA


>TTHERM_00992960(protein)
MASNRRSSAEPGHTESMVIVEEVIKDQGVIRRYSKGRFLGKGGFAKCYEFTNLERKQVLA
AKVIPKSSLTKSRARQKLMSEIRIHKSLNHRNIVKFQHFFEDQENVYILLEMCTNQTMNE
LIRRRKRLTELEVQCYLLQILYSIKYLHDNRVIHRDLKLGNLFLSDKMEIKLGDFGLATK
LEYDGERKRTICGTPNYIAPEILEAKETGHSYEVDVWSFGVIAYTLLIGKPPFETNDVKS
TYKKIRTNEYSFPEQIQISSAAKNMIKKILTTDPSKRPTINELFNDDFFKTGGSIPKLLP
VSTLACPPSASYTRQFLPSTQISLSTNQKSTNYQVENKNSSPKKFDNTTPINGNGFTRFA
TQTSYNPQNVKSQQQMGLKERKDYINTYRTGGAQTSSSSGLCNSQYGQKNFDTNNVNNQK
IDNFLQTNKNTYGLNGSVAKEQCFQKSSSLNPQSEGTTITNNLNLGILNFAKSQSTNTQL
VENSNLNSQKTDNYIQKMDECSQKAQPQVQNSNQHKSEDYSKNSCLTNQKYTSQASHPQS
QAALNSVQSQANIKNINNSTSIANFAYNQSSAAINSNTNLISTNLNNLSGGASSISNQNY
LSQNKNYPSQQSTNAVFNRNSIEKYSSSNNIRSGNSNYTRAKSEKMHTQPTSSLLQAYGF
TKVEQAPSSGTTALNFNNSGSYFQAPVSSNEVQIQGPDIWVSKWVDYSSKYGLGYLLNNG
QAGVFFNDSTKIILNPKTEQFDYIERNSSSKQDFGAEYTLKDYPESLQKKLTLLQHFRSF
LEGEDKKADSIKMPQNEASGEPKSSKIYVKKWLRTKNAILFRLSNKVVQVIFQDSSEIIL
SSELRAVTYVNRKKQRETFPLSTAMESQNKEMSKRLTYTKDILTHMLSGNVQSKGEQQNN
ENISVQDPTSTITNPIGLINQNQDGKEKNHSKNQSINPNSCSSASLYPTATTTQYANNNS
SSQIQPSQKPSTRENLHYSKNVPLSSVTNSIYMQNQQSNPIYNNYTQNENVNVLLLNKQQ
SLQNQKPSINGYELNGFASSNSANKKESLATNSNIINSTEGKCLGQPSNIQNLLKSNSTI
GRMNSMNPTATSSLSNLNNFNNYVMSSRKTEN