Identifiers and Description

Gene Model Identifier

TTHERM_00999090

Standard Name

SLP1 (Scramblase-Like Protein 1)

Aliases

PreTt26088 | 189.m00066 | 3819.m00220

Description

SLP1 scramblase family protein; Scramblase family protein; redistributes plasma membrane asymmetry by transporting negatively charged phospholipids from inner leaflet to outer leaflet of lipid bilayer

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_19764.1 2.0006597401342834e-129
Description: scramblase (270 aa)
WormBase WBGene00011935 1.0002869940498747e-21
Description: locus:scrm-1 status:Confirmed UniProt:O45799 protein_id:CAB04754.2
Oxytricha Contig19049.0.g80 0.0000000000000299873730555305
Description: Scramblase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00999090(coding)
ATGTATCCACCATAATAGCAATAGTATAATCAATAACCCTATGGTTAAGGTTATGGATAA
TAAGGTATGCCTAACATTTAAATGATGCCTATGCAATAGTATGCAGTAGTGGCTATTTAA
AACGGATTGTAAAAGTTAGCTTCTGCTTAAGGTATATTTATTGAATAGAAGTTAGAAGTC
ATTGAGGCATTGACTGGATGCTAAACTCCTAATGTCTACAAGGTTTATCCTGCTGATGTT
AATGGTATATAAACATCAGATTAAACTATATTCAAGTGTAAAGAACTTAGTAACTGTTGT
GTACGTTAATGCATAGCCCCAAGCTGCCGTCCATTTGATATGGCAGTCACAAATTAGCAA
GGAAAATTAAATTATGGATAACTTTCTGGCTCAACTTTTATTTAAATGTAGCGTCCATTC
AAGTGTACATGCCTTTGCTTCAACCGTCCTGAACTCTCTGTAACAGTTGTAGAAAATGGG
ATGAATTAGTATCTAGGAAAAATTAGAGAACCATTTAGATTTTGTGATCTTTGCGTTGAA
ATTGAAGATGCTGCAGGCAATCTCAAGTTTATAATTTCTGGATCCTGCTGCTAACTTGGT
TATCTTTGTATGGGTTGCCCTTATCAATCTTGCCAAGAATTAACTTTTGAAGTAAAGAAT
CCAGCAGGTGAACTAATTACAAGAATTTTAAAGAAATCTGCAGGTTGTCTAAAGAGTTGT
TTTGGTAAAACAGATAACTTTACTATAGGTTTCCCTCCTGGTTTGTCTCCTGAAGACAAA
GCTCTTTTTATGGCTGCTACTCTTTTAATTGATTATATGTACTTTGAAAATAAAACAGAA
CAACCAAATGATTTATGA


>TTHERM_00999090(gene)
ATGTATCCACCATAATAGCAATAGTATAATCAATAACCCTATGGTTAAGGTTATGGATAA
TAAGGTATGCCTAACATTTAAATGATGCCTATGCAATAGTATGCAGTAGTGGCTATTTAA
AACGGATTGTAAAAGTTAGCTTCTGCTTAAGGTATATTTATTGAATAGAAGTTAGAAGTC
ATTGAGGCATTGACTGGATGCTAAACTCCTAATGTCTACAAGGTTTATCCTGCTGATGTT
AATGGTATATAAACATCAGATTAAACTATATTCAAGTGTAAAGAACTTAGTAACTGTTGT
GTACGTTAATGCATAGCCCCAAGCTGCCGTCCATTTGATATGGCAGTCACAAATTAGCAA
GGAAAATTAAATTATGGATAACTTTCTGGCTCAACTTTTATTTAAATGTAGCGTCCATTC
AAGTGTACATGCCTTTGCTTCAACCGTCCTGAACTCTCTGTAACAGTTGTAGAAAATGGG
ATGAATTAGTATCTAGGAAAAATTAGAGAACCATTTAGATTTTGTGATCTTTGCGTTGAA
ATTGAAGATGCTGCAGGCAATCTCAAGTTTATAATTTCTGGATCCTGCTGCTAACTTGGT
TATCTTTGTATGGGTTGCCCTTATCAATCTTGCCAAGAATTAACTTTTGAAGTAAAGAAT
CCAGCAGGTGAACTAATTACAAGAATTTTAAAGAAATCTGCAGGTTGTCTAAAGAGTTGT
TTTGGTAAAACAGATAACTTTACTATAGGTTTCCCTCCTGGTTTGTCTCCTGAAGACAAA
GCTCTTTTTATGGCTGCTACTCTTTTAATTGATTATATGTACTTTGAAAATAAAACAGAA
CAACCAAATGATTTATGA


>TTHERM_00999090(protein)
MYPPQQQQYNQQPYGQGYGQQGMPNIQMMPMQQYAVVAIQNGLQKLASAQGIFIEQKLEV
IEALTGCQTPNVYKVYPADVNGIQTSDQTIFKCKELSNCCVRQCIAPSCRPFDMAVTNQQ
GKLNYGQLSGSTFIQMQRPFKCTCLCFNRPELSVTVVENGMNQYLGKIREPFRFCDLCVE
IEDAAGNLKFIISGSCCQLGYLCMGCPYQSCQELTFEVKNPAGELITRILKKSAGCLKSC
FGKTDNFTIGFPPGLSPEDKALFMAATLLIDYMYFENKTEQPNDL