Identifiers and Description

Gene Model Identifier

TTHERM_01001260

Standard Name

ITU1 (Iota-TUbulin)

Aliases

PreTt15746 | 190.m00056 | 3820.m00279

Description

ITU1 tubulin/FtsZ family GTPase domain protein; Iota-tubulin

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

  • determination of intestine left/right asymmetry (IEA) | GO:0071908
  • galactose catabolic process via UDP-galactose (IEA) | GO:0033499

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_07346.1 1.999275900062694e-162
Description: tubulin/FtsZ family, GTPase domain-containing protein (438 aa)
SGD YFL037W 6.998985483803218e-56
Description: TUB2 Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules
WormBase WBGene00006538 1.9997255150861791e-53
Description: locus:tbb-4 Tubulin beta-4 chain status:Partially_confirmed UniProt:P41937 protein_id:CAA86310.1
Oxytricha Contig12717.0.g75 9.998397555368434e-52
Description: Tubulin/FtsZ family, GTPase domain
DictyBase DDB_G0269196 3.9991604984848653e-48
Description: tubB on chromosome: 1 position 3261649 to 3263130
Stentor Coeruleus SteCoe_5719 1.9287498479639178e-22
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_01001260(coding)
ATGTCTAGTATTGTTTCAATTGCAATAGGATAATGTGGTATTTCAATATAAGAAAAACAA
TGGATAACTCTGCTTTAAGAGTATGGGATTGATGAATACGGAATAATCAATAAATTGGAA
AATGATAAAAAATTAGACTCATATTTTTATGAAGTAAAAGAAAACGTTTACAAGCCTAGA
GCTCTTTTTACAGATTTAGATGATCATCGTATTAATTCCTTGCAGAATGCTGGTCTAAAA
TAACTATTTTAAGGAGTACCTACAGTTTATTCAATTGATGGTAGTCATAATCTGTTTGCA
AGGGGAATGTATTCAGTAGGAAGTTAATTAAAAGATGAAATTTAAAACTAAATTACATAT
TTATTAGAATAATGTGACAGTGTAGACTCTATCTAAATTTAAAACTCATTATGTGGAGGA
ACAGGTTCTGGGTTAGGTAGTTTAATATGTGATATACTATATGAGGTTGCTCCATAATAC
ATAACTAACAATCTTGTGTAATATCCAGATTTAAGCACATCAAGCTAAATGATACTAGAA
AATTATAATACTATCCTTGGTTAAAGTAGATAAGATGCTTTAACATTAACGTTACCCTTT
TGCAACTAAAATTTATAGTTTTTGAATGATGGCTCATATAAAATTTAAAAATAAAAAGGA
TTTGACAATATAAATAATGTTATATCACAAATTCACCCACTCATCACTAGTGGATCGAGA
TATCATGGCTCAATTAATGCAAGCACTAGAAAAATATGTACAAATATAATACCTTTTCCA
AGATTAAAACATATGAGTATGATCTGCTTACCTCTTAATTATTACAAATAAAAATAGTAA
ACATAATTAGATTATATAGAAATGATACATGATAGTGTTAATTAAGAATATTCTTTTTTC
AGTAAGGATACATTTAAAATATTGTGTTCTCATCATATGATACGGGGAGCTGATATTCAT
TAAGAAGAAATAGAATCAGAGTATAATAAATTATACAGATCAAATAATATTATTGCAACT
GATTGGATACCAAATTCTTGCTCAATTTCTTATTGCAATGTTCGATGTCAATACAATTCA
AAATTAATTTTTTCTATAATTTCAAATTAGAATATAGCTCGGTACTTTGAAAAATACACT
TAATAATATTCATAACTATTTAGAAGAAAGGCATATTTGCATTACTATCTATAAGAAGGT
ATGGATGAAATGGAGTTTACAGAAGCAGAATCAAATTCTAATGATTTAATATCTGAATAT
TAACCATGTGGATACTATGGTGAATATGAAGATTAAGATGAAGATGGGTATTATGATGAT
GATTAATAAATGTTAAGTTATTTTGATTGA


>TTHERM_01001260(gene)
ATGTCTAGTATTGTTTCAATTGCAATAGGATAATGTGGTATTTCAATATAAGAAAAACAA
TGGATAACTCTGCTTTAAGAGTATGGGATTGATGAATACGGAATAATCAATAAATTGGAA
AATGATAAAAAATTAGACTCATATTTTTATGAAGTAAAAGAAAACGTTTACAAGCCTAGA
GCTCTTTTTACAGATTTAGATGATCATCGTATTAATTCCTTGCAGAATGCTGGTCTAAAA
TAACTATTTTAAGGAGTACCTACAGTTTATTCAATTGATGGTAGTCATAATCTGTTTGCA
AGGGGAATGTATTCAGTAGGAAGTTAATTAAAAGATGAAATTTAAAACTAAATTACATAT
TTATTAGAATAATGTGACAGTGTAGACTCTATCTAAATTTAAAACTCATTATGTGGAGGA
ACAGGTTCTGGGTTAGGTAGTTTAATATGTGATATACTATATGAGGTTGCTCCATAATAC
ATAACTAACAATCTTGTGTAATATCCAGATTTAAGCACATCAAGCTAAATGATACTAGAA
AATTATAATACTATCCTTGGTTAAAGTAGATAAGATGCTTTAACATTAACGTTACCCTTT
TGCAACTAAAATTTATAGTTTTTGAATGATGGCTCATATAAAATTTAAAAATAAAAAGGA
TTTGACAATATAAATAATGTTATATCACAAATTCACCCACTCATCACTAGTGGATCGAGA
TATCATGGCTCAATTAATGCAAGCACTAGAAAAATATGTACAAATATAATACCTTTTCCA
AGATTAAAACATATGAGTATGATCTGCTTACCTCTTAATTATTACAAATAAAAATAGTAA
ACATAATTAGATTATATAGAAATGATACATGATAGTGTTAATTAAGAATATTCTTTTTTC
AGTAAGGATACATTTAAAATATTGTGTTCTCATCATATGATACGGGGAGCTGATATTCAT
TAAGAAGAAATAGAATCAGAGTATAATAAATTATACAGATCAAATAATATTATTGCAACT
GATTGGATACCAAATTCTTGCTCAATTTCTTATTGCAATGTTCGATGTCAATACAATTCA
AAATTAATTTTTTCTATAATTTCAAATTAGAATATAGCTCGGTACTTTGAAAAATACACT
TAATAATATTCATAACTATTTAGAAGAAAGGCATATTTGCATTACTATCTATAAGAAGGT
ATGGATGAAATGGAGTTTACAGAAGCAGAATCAAATTCTAATGATTTAATATCTGAATAT
TAACCATGTGGATACTATGGTGAATATGAAGATTAAGATGAAGATGGGTATTATGATGAT
GATTAATAAATGTTAAGTTATTTTGATTGA


>TTHERM_01001260(protein)
MSSIVSIAIGQCGISIQEKQWITLLQEYGIDEYGIINKLENDKKLDSYFYEVKENVYKPR
ALFTDLDDHRINSLQNAGLKQLFQGVPTVYSIDGSHNLFARGMYSVGSQLKDEIQNQITY
LLEQCDSVDSIQIQNSLCGGTGSGLGSLICDILYEVAPQYITNNLVQYPDLSTSSQMILE
NYNTILGQSRQDALTLTLPFCNQNLQFLNDGSYKIQKQKGFDNINNVISQIHPLITSGSR
YHGSINASTRKICTNIIPFPRLKHMSMICLPLNYYKQKQQTQLDYIEMIHDSVNQEYSFF
SKDTFKILCSHHMIRGADIHQEEIESEYNKLYRSNNIIATDWIPNSCSISYCNVRCQYNS
KLIFSIISNQNIARYFEKYTQQYSQLFRRKAYLHYYLQEGMDEMEFTEAESNSNDLISEY
QPCGYYGEYEDQDEDGYYDDDQQMLSYFD