Identifiers and Description

Gene Model Identifier

TTHERM_01001420

Standard Name

CTH50 (CaTHepsin 50)

Aliases

PreTt15761 | 190.m00071 | 3820.m00292

Description

CTH50 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_19731.1 9.997093137033517e-262
Description: papain family cysteine protease containing protein (361 aa)
Oxytricha Contig1254.0.g80 3.0013832822195203e-89
Description: Papain family cysteine protease
WormBase WBGene00000776 9.996162112727537e-67
Description: locus:cpl-1 status:Confirmed UniProt:O45734 protein_id:CAB07275.1
DictyBase DDB_G0281605 3.998564387823535e-58
Description: cfaD on chromosome: 3 position 4701100 to 4702904
Stentor Coeruleus SteCoe_29480 4.0795586671775603e-41
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01001420(coding)
ATGAAACAATAAGCTTTGTTTATTACATTAGCCATCTTCGTCTGCTTTGCCGCAGCCTAA
GAATTCGAAGTTAAGGAAGGTCTTTTAAATAATATCCTCCCCTTACACGACGACTACGTC
TTATCTCTTGCTAGATTATACAGACCTCATTTAAATGTTGAACATTTAGAATTCTAACAC
TTCAAGGAATCTGTTAGAAGAGTTAGAGAACACAACAAAAAGGTAAATGCTACCTATACT
TTATCTATCGATTCACCTTTTGCTTTCATGTCCGATGAATAATTCGTTACTGAATATCTT
GGTTCTTAAGATTGCTCTGCTACTGCTGAACTCACCCTTAAGAAGCCTATGAAGATCCAA
AATAAGAAGAACGTTTAAGTCCCTGAAAGCATTAACTGGAAAGACCTTAACAAGGTTAGC
CCTGTCAAGGATCAACAAAATTGCGGTTCTTGCTGGACCTTCTCCACTACCGGAGCTATT
GAATCTCACTATGCCATTTTTGAAGACGTCGAACCTACTTCTCTCTCTGAATAACAATTG
ATTGACTGCGCTGGTGCTTTTAATAACAATGGTTGCAGTGGTGGTTTACCCTCTTAAGCT
TTCGAATATATCAAATACAATGGTGGTATTTCTTATGAAAACTCATATTACTATATTGCT
CAAGATCAAGAATGTTAATTCAGCCCTGAAACTGTTGGTGCTAGAGTTAGGGGTGGTTCT
TTCAACATTACTTAAGGTGATGAAGATTAATTGAAGCAAGCTGTTGGTACCGTTGGTCCT
GTATCTATTGCTTTCTAGGTTATGGGTGATTTCAAGCTTTACAAGTCTGGTGTCTACTCC
AATCCTGACTGTTCAAGCTCTCCTCAAACTGTTAACCACGCTGTCTTAGCTGTCGGATAC
GGTTCTGAAAATGGTGTTGATTACTGGTACGTTAAAAACTCTTGGAGTGAATTCTGGGGT
GACGAAGGTTACTTCAAGATCCAAAGAGGTGTTAACATGTGTGGTGTCGCCACTTGTGCT
TCTTATCCTCTTCTTGAAGAATAAACCGAAGTTTCTGCTGAATCCTTCTGA


>TTHERM_01001420(gene)
ATGAAACAATAAGCTTTGTTTATTACATTAGCCATCTTCGTCTGCTTTGCCGCAGCCTAA
GAATTCGAAGTTAAGGAAGGTCTTTTAAATAATATCCTCCCCTTACACGACGACTACGTC
TTATCTCTTGCTAGATTATACAGACCTCATTTAAATGTTGAACATTTAGAATTCTAACAC
TTCAAGGAATCTGTTAGAAGAGTTAGAGAACACAACAAAAAGGTAAATGCTACCTATACT
TTATCTATCGATTCACCTTTTGCTTTCATGTCCGATGAATAATTCGTTACTGAATATCTT
GGTTCTTAAGATTGCTCTGCTACTGCTGAACTCACCCTTAAGAAGCCTATGAAGATCCAA
AATAAGAAGAACGTTTAAGTCCCTGAAAGCATTAACTGGAAAGACCTTAACAAGGTTAGC
CCTGTCAAGGATCAACAAAATTGCGGTTCTTGCTGGACCTTCTCCACTACCGGAGCTATT
GAATCTCACTATGCCATTTTTGAAGGTATAAAATTTTTTAATTTTTGGTATTTAATATTA
ATTAATTTATATTTTTAATTTAAATAGACGTCGAACCTACTTCTCTCTCTGAATAACAAT
TGATTGACTGCGCTGGTGCTTTTAATAACAATGGTTGCAGTGGTGGTTTACCCTCTTAAG
CTTTCGAATATATCAAATACAATGGTGGTATTTCTTATGAAAACTCATATTACTATATTG
CTCAAGATCAAGAATGTTAATTCAGCCCTGAAACTGTTGGTGCTAGAGTTAGGGGTGGTT
CTTTCAACATTACTTAAGGTGATGAAGATTAATTGAAGCAAGCTGTTGGTACCGTTGGTC
CTGTATCTATTGCTTTCTAGGTTATGGGTGATTTCAAGCTTTACAAGTCTGGTGTCTACT
CCAATCCTGACTGTTCAAGCTCTCCTCAAACTGTTAACCACGCTGTCTTAGCTGTCGGAT
ACGGTTCTGAAAATGGTGTTGATTACTGGTACGTTAAAAACTCTTGGAGTGAATTCTGGG
GTGACGAAGGTTACTTCAAGATCCAAAGAGGTGTTAACATGTGTGGTGTCGCCACTTGTG
CTTCTTATCCTCTTCTTGAAGAATAAACCGAAGTTTCTGCTGAATCCTTCTGA


>TTHERM_01001420(protein)
MKQQALFITLAIFVCFAAAQEFEVKEGLLNNILPLHDDYVLSLARLYRPHLNVEHLEFQH
FKESVRRVREHNKKVNATYTLSIDSPFAFMSDEQFVTEYLGSQDCSATAELTLKKPMKIQ
NKKNVQVPESINWKDLNKVSPVKDQQNCGSCWTFSTTGAIESHYAIFEDVEPTSLSEQQL
IDCAGAFNNNGCSGGLPSQAFEYIKYNGGISYENSYYYIAQDQECQFSPETVGARVRGGS
FNITQGDEDQLKQAVGTVGPVSIAFQVMGDFKLYKSGVYSNPDCSSSPQTVNHAVLAVGY
GSENGVDYWYVKNSWSEFWGDEGYFKIQRGVNMCGVATCASYPLLEEQTEVSAESF