Identifiers and Description

Gene Model Identifier

TTHERM_01005130

Standard Name

RPN13 (26S proteasome regulatory subunit)

Aliases

PreTt27630 | 192.m00068 | 3757.m00316

Description

RPN13 ubiquitin carboxy-terminal hydrolase 37 receptor-binding site protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_19886.1 4.001580524003507e-155
Description: hypothetical protein (334 aa)
Oxytricha Contig1035.0.1.g71 1.0004783691736523e-35
Description: Proteasome complex subunit Rpn13 ubiquitin receptor
DictyBase DDB_G0272624 2.000769134519826e-18
Description: adrm1-1 on chromosome: 2 position 2270218 to 2271796
WormBase WBGene00016981 0.00000000002000577768187062
Description: Proteasomal ubiquitin receptor ADRM1 homolog status:Confirmed UniProt:Q09289 protein_id:CCD66338.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01005130(coding)
ATGAGTTTAGATTTTGTCAAGGAATATTCTTTTAAGGCAGGAATTATGAATTTAGATCCC
ACAACCAAAAAGGTTACTGCTGATAAAAGAAAAGGAACTGTAAAAATTGGATGCACTTTA
GAAGGCGAGAAACCTTTTACCTGGACACCTGAAGGAGCTACTGAACCCGAATTTGAATAT
GCAGTAATGTAAAGTGATGCTTCTCTAGAATTGTCTAAGTAAATGAAAAGAGTTGTAGTT
TTGAGATTTTAATGTGATGAATCAAGATACTTCTTTTGGCTTTAAGAAAAAGATGCTTCC
AAAGATGCTGAAATTGTTAGTAGAGTATAAGACATTATTGATTTTGATATTGAATAATTA
ATGATAGATGAATCATCTTCTGTTTCAGAACCTTAATAATCACTTTCTCAGTAATCTTCA
TCTTAATCCTAACCTTAACCTGCCCAATAAGGTTAACCAAATTTAATGAATGCTAATCTT
TTTGGTGCTCAATTTTAAGATATGTTTTAAAACATGTTAAATCAAAGAGGAGGAAATAAT
AATCCAATGATGTAATAACTTTTGTAATAATACTAGCAAAGATAAAGAGATACTCCCAAT
TTCTTTGAAGTATTAACTAAAGAAAGTTTAATGGAATTAGCAAACGACGAAGAAGTCTAA
AAAGAGCTTATTTAGCATTTACCTGAAGGATAATAGGATGTTTAAAATTTAAAAGAAAAT
TTGATTAGTCCACAATTCTAATAAGCACTAGAATCATTAGAAAAAGCTCTTAATTCCAAT
GAGGGAGGAGCTGTATTAGCTTCATTAGGATTAGACTAATCTAATTTTATGGAAACTCTT
GATGGATCTGACTCATTCTATAAAGCAATAATCAAATGGGCTGAATCATAGAAGAAATAA
TGA


>TTHERM_01005130(gene)
ATGAGTTTAGATTTTGTAAAAAAAATATAACTTTTTGTAATAAGCAATGAAAATTTATAA
AATTTATTGTATACTTATAGGTCAAGGAATATTCTTTTAAGGCAGGAATTATGAATTTAG
ATCCCACAACCAAAAAGGTTACTGCTGATAAAAGAAAAGGAACTGTAAAAATTGGATGCG
TATGTTTATTTTAAACTTTGAAAAATTGATAAGTTTACATAGAGGTTTTTTATATTAATA
AAAGACTTTAGAAGGCGAGAAACCTTTTACCTGGACACCTGAAGGAGCTACTGAACCCGA
ATTTGTAAAATAATAGATTTGTTATTTATTTAGATCCTATGAGAATAATAAATATACATC
CAAACTAATTTACATTCAATTTTAAAAACATTTAGGAATATGCAGTAATGTAAAGTGATG
CTTCTCTAGAATTGTCTAAGTAAATGAAAAGAGTTGTAGTTTTGAGATTTTAATGTGATG
AATCAAGATACTTCTTTTGGCTTTAAGTAAAAATTTGAATATCGAAGCATATAAATAGAA
TTCTGATAATATTTATTAGAAGAAGATCAGATTTCTATATTAACAAACCTTACTCTCGAT
TATGTTTTAATTAAATTCTTATATTTTTATAAAGGAAAAAGATGCTTCCAAAGATGCTGA
AATTGTTAGTAGAGTATAAGACATTATTGATTTTGATATTGAATAATTAATGATAGATGA
ATCATCTTCTGTTTCAGAACCTTAATAATCACTTTCTCAGTAATCTTCATCTTAATCCTA
ACCTTAACCTGCCCAATAAGGTTAACCAAATTTAATGAATGCTAATCTTTTTGGTGCTCA
ATTTTAAGATATGTTTTAAAACATGTTAAATCAAAGAGGAGGAAATAATAATCCAATGAT
GTAATAACTTTTGTAATAATACTAGCAAAGATAAAGAGATAGTAAAATTGTTTAAACTTT
AATAAGTTATTTATTGTAAAGAAAAATAAATAATTAATTTAGCTCCCAATTTCTTTGAAG
TATTAACTAAAGAAAGTTTAATGGAATTAGCAAACGACGAAGAAGTCTAAAAAGAGCTTA
TTTAGTAAATTAAAAACTTAAAATGAAATCTAATAAAATATGCTTTAAAAATTTCTAGGC
ATTTACCTGAAGGATAATAGGATGTTTAAAATTTAAAAGAAAATTTGATTAGTCCACAAT
TCTAATAAGCACTAGAATCATTAGAAAAAGCTCTTAATTCCAATGAGGGAGGAGCTGTAT
TAGCTTCATTAGGATTAGACTAATCTAATTTTATGGAAACTCTTGATGGTAATTAAATCA
CTAAAAAATTAAATATAATCATATTTAAATTATTTTTATCATCTTATTAATTAGGATCTG
ACTCATTCTATAAAGCAATAATCAAATGGGCTGAATCATAGAAGAAATAATGA


>TTHERM_01005130(protein)
MSLDFVKEYSFKAGIMNLDPTTKKVTADKRKGTVKIGCTLEGEKPFTWTPEGATEPEFEY
AVMQSDASLELSKQMKRVVVLRFQCDESRYFFWLQEKDASKDAEIVSRVQDIIDFDIEQL
MIDESSSVSEPQQSLSQQSSSQSQPQPAQQGQPNLMNANLFGAQFQDMFQNMLNQRGGNN
NPMMQQLLQQYQQRQRDTPNFFEVLTKESLMELANDEEVQKELIQHLPEGQQDVQNLKEN
LISPQFQQALESLEKALNSNEGGAVLASLGLDQSNFMETLDGSDSFYKAIIKWAESQKKQ