Identifiers and Description

Gene Model Identifier

TTHERM_01005190

Standard Name

ARP6 (Actin-Related Protein 6)

Aliases

PreTt27636 | 192.m00074 | 3757.m00322

Description

ARP6 actin; Member of the SWR complex. Actin family protein.

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Vegetative Cell Cycle (Zhang et al., 2023)

GeneMania

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_19894.1 9.997093137033517e-262
Description: actin family protein (401 aa)
Oxytricha Contig9419.0.g21 1.9999590304423412e-72
Description: Actin
WormBase WBGene00007434 7.001890014428386e-55
Description: locus:arp-6 Actin-like protein C08B11.6 status:Confirmed UniProt:Q09443 protein_id:CAA86667.3
SGD YFL039C 4.997755005759707e-41
Description: ACT1 Actin, structural protein involved in cell polarization, endocytosis, and other cytoskeletal functions
DictyBase DDB_G0274131 7.003455847728069e-40
Description: act17 on chromosome: 2 position 4723516 to 4724640
Stentor Coeruleus SteCoe_22192 2.1151310375910805e-19
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_01005190(coding)
ATGAGCGATTGGAAGACAAATTTAAATAAAAGATTAATAGTGGATAATGGTTCTTGGGAA
ATAAGATTAGGATCTGCTTTAAATGAAGTACCTAATTTAACTTACTATAATTTATTAGGT
ATTGACAGAAAAAATGGTAATTTGTTATGCGGAGAGAATTTAAATAACTACATAGATGAA
GCTAATTTGATATATGTAAAGCCTTAAGTAAGGGGTGTTGTAGTTGATTGGGATCATGAA
GTTCATTTATGGGAAAAAATGCTAGATGCTTAAACAGAATTTGAATCAAAATAAAACGAG
TTATAATCTTATAGTATTAGTATATTGCACAACCCTTGCGTACCTGATAAAGTTAGATAA
AGAATGATTGAAGTTTGTTTTGAGTATTTTGGATTTGATGCAATATATCCTGCTTTATCT
CAACAAATGTCTCAAATACACGCTTTAGATAAATACAATAAAAAAATAAGCGACACTTTT
CAGTTAGTTATAGAAATAGGGCACTCTGCTACTTACTTTGTGCCTTTCTTTGATGGATAA
CCTATAAATTATGCAATTAAAAGATTAGATGTTGGTGGTAAATTACTTACAAACCATTTG
AAAGAAATTATTACATGCAGATATATTCAGCTAAAAAACGAAATTAGAATGGTTTCTCAA
ATTAAAGAGGACATGTGTTTTGTGTCACAAAATTTTTAAAAAGATATCAAATTGCGAAAA
GGCTCTCATACCAAGTATTTTATTTTACCTGATTACGAGACAGGTAAAAAAGGTTTTGCT
GTAGATTTCTATGATAGATCTTCTTATAGTGATAAGCTAACTTTAGACAAAGAGAGATTC
ACCCTTCCAGAAATATTGTTTAATCCAAGTGATATAGGTTTAGATTAATGTGGTATCTCA
TAAGGCGCAAGCAGTGTTATTAAGGAAATACATCCTGATATTAAAGAATACTTCTATGAG
AATATCATTTTATGTGGTGGATCATCAAATTTTGTGGGCTTAAAAGAAAGACTATTAAAT
GAAGTCACTTAGAATACTCCTGATTATTTAGATAATAAATTAGTTCATCTCAAAGACACT
TCATCAGCTTATTAGGGATGTTAAAGGGTAACTTCAGGAGATAATTTTGAAATGCTAGCT
ATGAATAGAAATGATTATAAAGAATATGGATTTGAACAACTAAATGCTCTGTATTTTATT
TGA


>TTHERM_01005190(gene)
ATGAGCGATTGGAAGACAAATTTAAATAAAAGATTAATAGTGGATAATGGTTCTTGGGAA
ATAAGATTAGGATCTGCTTTAAATGAAGTACCTAATTTAACTTACTATAATTTATTAGGT
AAATTTAAATGAGAGAAAGTTTGATCAGTTTTTTAGCTTATAATATTTGTTAGGTATTGA
CAGAAAAAATGGTAATTTGTTATGCGGAGAGAATTTAAATAACTACATAGATGAAGCTAA
TTTGATATATGTAAAGCCTTAAGTAAGGGGTGTTGTAGTTGATTGGGATCATGAAGTTCA
TTTATGGGAAAAAATGTCATTATTTATTTTCAATCAGAATAAATGAAAAATTGAAATAAT
TTTTAAAAAACAGGCTAGATGCTTAAACAGAATTTGAATCAAAATAAAACGAGTTATAAT
CTTATAGTATTAGTATATTGCACAACCCTTGCGTACCTGATAAAGTTAGATAAAGAATGA
TTGAAGTTTGTTTTGAGTATTTTGGATTTGATGCAATATATCCTGCTTTATCTCAACAAA
TGTCTCAAATACACGCTTTAGATAAATACAATAAAAAAATAAGCGACACTTTTCAGTTAG
TTATAGAAATAGGGCACTCTGCTACTTACTTTGTGCCTTTCTTTGATGGATAACCTATAA
ATTATGCAATTAAAAGATTAGATGTTGGTAATAATAAATAAAATATTAATTATTAAGATA
TTTATTTAAATATTAATTAATTCCAATATTTAATTAGAATATTTATAATTTAATTATAAA
ATATTTTTTATAGGTGGTAAATTACTTACAAACCATTTGAAAGAAATTATTACATGCAGA
TATATTCAGCTAAAAAACGAAATTAGAATGGTTTCTCAAATTAAAGAGGACATGTGTTTT
GTGTCACAAAATTTTTAAAAAGATATCAAATTGCGGTAATAATAATTTATTATTAATTCT
TATATGAGATAAATAAATAAATTTAGCAATTAATTAATATCAACACTCTTAGATATTTAT
TCAATTTATAATTTAAAAATAATATCAGAAAAGGCTCTCATACCAAGTATTTTATTTTAC
CTGATTACGAGACAGGTAAAAAAGGTTTTGCTGTAGATTTCTATGATAGATGTAATTAAA
ACATATTTTTAATGATTCTTGCTAACAAATCTTTTCAAATTAAAAGCTTCTTATAGTGAT
AAGCTAACTTTAGACAAAGAGAGATTCACCCTTCCAGAAATATTGTTTAATCCAAGTGAT
ATAGGTATCAAGCACATTATTTTATTTTTTATTCATCATCTTAAATTGAATTAGATAAAA
ATTTGTTAACTATTACCATTTAAAACTCCTTTTCTTAGCAAAAATGATTAGTGATTTTAC
ATTTGAAAATCCCAAAATTAATTGCAAAAATAGAAAGTGTAAATTGTAATTTAAATGGTA
TTCCTTTAAAAAAATAAATCTATCTAAATAAATAAATAATTTAAAAAAATGAAAATAATG
TGAGTAGATATAAATAATTCTCTTAACTGTTTTAAATAGGTTTAGATTAATGTGGTATCT
CATAAGGCGCAAGCAGTGTTATTAAGGAAATACATCCTGATATTAAAGAATACTTCTATG
AGAATATCATTTTATGTGGTGGATCATCAAATTTTGTGGGCTTAAAAGAAAGACTGTAAG
ATATATTAATTAATTAGTTATATTAATTGATTACATTTATTTTACTAAAATTAGATTAAA
TGAAGTCACTTAGAATACTCCTGATTATTTAGATAATAAATTAGTTCATCTCAAAGACAC
TTCATCAGCTTATTAGGGATGTTAAAGGGTAACTTCAGGAGATAATTTTGAAATGCTAGC
TATGAATAGAAATGATTATAAAGAATATGGATTTGAACAACTAAATGCTCTGTATTTTAT
TTGA


>TTHERM_01005190(protein)
MSDWKTNLNKRLIVDNGSWEIRLGSALNEVPNLTYYNLLGIDRKNGNLLCGENLNNYIDE
ANLIYVKPQVRGVVVDWDHEVHLWEKMLDAQTEFESKQNELQSYSISILHNPCVPDKVRQ
RMIEVCFEYFGFDAIYPALSQQMSQIHALDKYNKKISDTFQLVIEIGHSATYFVPFFDGQ
PINYAIKRLDVGGKLLTNHLKEIITCRYIQLKNEIRMVSQIKEDMCFVSQNFQKDIKLRK
GSHTKYFILPDYETGKKGFAVDFYDRSSYSDKLTLDKERFTLPEILFNPSDIGLDQCGIS
QGASSVIKEIHPDIKEYFYENIILCGGSSNFVGLKERLLNEVTQNTPDYLDNKLVHLKDT
SSAYQGCQRVTSGDNFEMLAMNRNDYKEYGFEQLNALYFI