Identifiers and Description

Gene Model Identifier

TTHERM_01008630

Standard Name

THC1 (Tetrahymanol cyclase)

Aliases

PreTt29567 | 194.m00023

Description

THC1 squalene-tetrahymanol cyclase; Metabolic enzyme involved in triterpenoids biosynthesis; catalyzes the formation of tetrahymanol from squalene by a direct cyclization. (US PATENT 7105324 B2- 2006)

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00432 ) Prenyltransferase and squalene oxidase repeat
  • ( PF01473 ) Putative cell wall binding repeat
  • ( PF01753 ) MYND finger
  • ( PF06571 ) Protein of unknown function (DUF1130)
  • ( PF07678 ) A-macroglobulin complement component
  • ( PF07966 ) A1 Propeptide
  • ( TIGR00072 ) hydrogenase maturation protease
  • ( TIGR00255 ) conserved hypothetical protein TIGR00255
  • ( TIGR01507 ) squalene-hopene cyclase
  • ( TIGR01787 ) squalene/oxidosqualene cyclases

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_13560.1 9.997093137033517e-262
Description: hypothetical protein (656 aa)
DictyBase DDB_G0269226 5.997612587164444e-16
Description: cas1 on chromosome: 1 position 3476704 to 3479389
SGD YHR072W 0.00000000002000577768187062
Description: ERG7 Lanosterol synthase, an essential enzyme that catalyzes the cyclization of squalene 2,3-epoxide, a step in ergosterol biosynthesis

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01008630(coding)
ATGAAGAAGATACTCATAGGCTTAATTATAGGTCTCTTTTTATTCTCAAGCGTTAATGCC
AGCGTTAATCTCACTGAAGTCTAAAATGCCATCTCTATCTAGCAAGGCATTAATTGGGCA
GAAGTACACAACAATACTTGGTACTATCCTCCTTACTTAGGCGAAATGTTTATCAGTGAA
TACTACTTCGAGTTACTCGTCTTGAATTGGACTCATAAATCTGCTTTCAACGCTACATAC
TTTACAGAACGTCTCCTCTAGACTTAATTCGAAGATGGTTCATGGGAGCAAGTCAGAGAA
CAAAATCTTGAAACTGGTTAGTTAGATGCTACTGTCTTTAACTACTGGTACTTAAAGTCT
ATTAACAACAATCCTAAAATTGAAGCTGCTCTATAAAAGGCTAGAAAATGGATAGTTGCT
TAGGGTGGTATTGAAGCAACTCAAACAATGACCAAGTTTAAGTTAGCAGCCTTCGGTTAA
TACAGTTGGGAAGATTTATGGTATGTCCCATTGTTCATCTTCAAGTAGAATGGAATTTTC
AAATATACCTACGTTAAGGATATTGTTGCATAATGGGTCTATCCACATTTAACTGCCTTA
GCTTATTTGCGTTACTAAAGAACTGTTTTCAATGTTCCTGTTGCTGATTTGAGAGAGCTC
TGGATCAATTACCCTAAGAACGGTATTAAAATCAGTCCAAGAGAATACTCTACACTTAAT
CCTGATAGCGATCTCTTGATCTTAATGGACGAAATCTTCAAACTTAAACAACCTCTTGGA
AGTTTCGGTGCCTACACTATTTCAACCCTCTTGACTTTAATGTCCTTCAAAGACTTTTAG
TCAAAGCACCCTCATCTATACCAAAACGAAATACAAAAGGCTTACGAAGACGGATACTAT
TTCGTTGAGTTTAACTACTTTAACTTTAGAGAAGCTTATCACGGCTCTTTGGATGATGGT
AGATGGTGGGATACCATTCTTATTAGTTGGGCTATGCTTGAAAGTGGCTAAGATAAAGAA
AGAATCTTCCCTATCGTATAAAATATGGTCAAAGAAGGTCTTTAACCTAAAAAAGGTATA
GGTTATGGATATGATTTCGAATATGCTCCTGACACTGATGACACTGGATTACTTCTCGTT
GTTATGAGTTACTACAAAGAAGCCTTCTAAAAGTAAATCCCTGAAACTATTGAATGGCTT
TTCTCTATGCAAAATGACGATGGTGGCTATCCAGCTTTTGACAAAGGTAAAAATGAAGAC
AATTTATTGTTCAAGTTTGCCTTCAATATGGCTGGTATTGCTAACTCAGCTGAAATCTTC
GATCCCTCATGTCCTGATATTACTGGTCACATCATGGAAGGATTGGGTGAGTTTGGATAT
CAAGCTAATCATCCTTAGATTTAAAATATGATTAAATATCAAAGAAAGACTTAGAACAAG
TGGGGATCTTGGTAAGCTAGATGGGGTGTAAATTACATTATGGCTGTTGGAGCTGTTGTA
CCAGGTTTAGCAAGAGTCAATTACGACTTAAATGAACAGTGGGTACAAAATAGTATAAAT
TATTTGCTTAATAAATAAAATAAAGATGGTGGCTTTGGTGAATGTGTCCTTTCTTATAAT
GATCCTGAAAAGTGGAATGGTATAGGTAAATCTACTGTCACTCAAACCTCATGGGGACTA
TTAGCTCTTTTAGAAGTTTATAATTAAAATGAACAAATTAAGCATGCTGCAGATAGAGCT
GCTTAGTATTTATTAGATTAATTCAAAAGAGACGATAATACCTTCTATGATCACTCCACA
ATAGGAACAGGTCACAGAGGATTACTCTATTTATAGTACCCCTCATATGCACAATCATTC
CCATTAGTAGCTTTAAATAGATACTAAAAAATATCTCAAGGTTAATATCACTTCTCCAAA
AATTTGTACAATGGTAATGGAGAACCTGTATAAAAATAAAATATTTGA


>TTHERM_01008630(gene)
ATGAAGAAGATACTCATAGGCTTAATTATAGGTCTCTTTTTATTCTCAAGCGTTAATGCC
AGCGTTAATCTCACTGAAGTCTAAAATGCCATCTCTATCTAGCAAGGCATTAATTGGGCA
GAAGTACACAACAATACTTGGTACTATCCTCCTTACTTAGGCGAAATGTTTATCAGTGAA
TACTACTTCGAGTTACTCGTCTTGAATTGGACTCATAAATCTGCTTTCAACGCTACATAC
TTTACAGAACGTCTCCTCTAGACTTAATTCGAAGATGGTTCATGGGAGCAAGTCAGAGAA
CAAAATCTTGAAACTGGTTAGTTAGATGCTACTGTCTTTAACTACTGGTACTTAAAGTCT
ATTAACAACAATCCTAAAATTGAAGCTGCTCTATAAAAGGCTAGAAAATGGATAGTTGCT
TAGGGTGGTATTGAAGCAACTCAAACAATGACCAAGTTTAAGTTAGCAGCCTTCGGTTAA
TACAGGTAAAGTTTCTTTTTCATCAATATTTTAGAAATAAACAATCAATTTTAAATTATT
CTCCCATATTTTGCTCAAATAATAATTTCTACTTAAATAATTAGCTTCAACTGCAAATAT
AAAAATGAATTAATTTATTATAAATAAAAGCAGTAAATATAAGCAAATATACTAATTTAA
TTAGCTTATTATTCTGTTAATATTTAAAAGCCATTTTGACTCAATAGCTTATTTTATTTT
AAATAATTAAATAGTTGGGAAGATTTATGGTATGTCCCATTGTTCATCTTCAAGTAGAAT
GGAATTTTCAAATATACCTACGTTAAGGATATTGTTGCATAATGGGTCTATCCACATTTA
ACTGCCTTAGCTTATTTGCGTTACTAAAGAACTGTTTTCAATGTTCCTGTTGCTGATTTG
AGAGAGCTCTGGATCAATTACCCTAAGAACGGTATTAAAATCAGTCCAAGAGAATACTCT
ACACTTAATCCTGATAGCGATCTCTTGATCTTAATGGACGAAATCTTCAAACTTAAACAA
CCTCTTGGAAGTTTCGGTGCCTACACTATTTCAACCCTCTTGACTTTAATGTCCTTCAAA
GACTTTTAGTCAAAGCACCCTCATCTATACCAAAACGAAATACAAAAGGCTTACGAAGAC
GGATACTATTTCGTTGAGTTTAACTACTTTAACTTTAGAGAAGCTTATCACGGCTCTTTG
GATGATGGTAGATGGTGGGATACCATTCTTATTAGTTGGGCTATGCTTGAAAGTGGCTAA
GATAAAGAAAGAATCTTCCCTATCGTATAAAATATGGTCAAAGAAGGTCTTTAACCTAAA
AAAGGTATAGGTTATGGATATGATTTCGAATATGCTCCTGACACTGATGACACTGGATTA
CTTCTCGTTGTTATGAGTTACTACAAAGAAGCCTTCTAAAAGTAAATCCCTGAAACTATT
GAATGGCTTTTCTCTATGCAAAATGACGATGGTGGCTATCCAGCTTTTGACAAAGGTAAT
TTAATATTGATAATTTATTCCATTTCTTTATTTAATAAAAATAAATCTTTTAATTATTTC
AATTGAAAGATACATTTAAATAAAATTACAAATGTACTTAAAATAAATATAATATTATTA
ACACTTCTACTTTATTTTAAAATAGGTAAAAATGAAGACAATTTATTGTTCAAGTTTGCC
TTCAATATGGCTGGTATTGCTAACTCAGCTGAAATCTTCGATCCCTCATGTCCTGATATT
ACTGGTCACATCATGGAAGGATTGGGTGAGTTTGGATATCAAGCTAATCATCCTTAGATT
TAAAATATGATTAAATATCAAAGAAAGACTTAGAACAAGTGGGGATCTTGGTAAGCTAGA
TGGGGTGTAAATTACATTATGGCTGTTGGAGCTGTTGTACCAGGTTTAGCAAGAGTCAAT
TACGACTTAAATGAACAGTGGGTACAAAATAGTATAAATTATTTGCTTAATAAATAAAAT
AAAGATGGTGGCTTTGGTGAATGTGTCCTTTCTTATAATGATCCTGAAAAGTGGAATGGT
ATAGGTAAATCTACTGTCACTCAAACCTCATGGGGACTATTAGCTCTTTTAGAAGTTTAT
AATTAAAATGAACAAATTAAGCATGCTGCAGATAGAGCTGCTTAGTATTTATTAGATTAA
TTCAAAAGAGACGATAATACCTTCTATGATCACTCCACAATAGGAACAGGTCACAGAGGA
TTACTCTATTTATAGTACCCCTCATATGCACAATCATTCCCATTAGTAGCTTTAAATAGA
TACTAAAAAATATCTCAAGGTTAATATCACTTCTCCAAAAATTTGTACAATGGTAATGGA
GAACCTGTATAAAAATAAAATATTTGA


>TTHERM_01008630(protein)
MKKILIGLIIGLFLFSSVNASVNLTEVQNAISIQQGINWAEVHNNTWYYPPYLGEMFISE
YYFELLVLNWTHKSAFNATYFTERLLQTQFEDGSWEQVREQNLETGQLDATVFNYWYLKS
INNNPKIEAALQKARKWIVAQGGIEATQTMTKFKLAAFGQYSWEDLWYVPLFIFKQNGIF
KYTYVKDIVAQWVYPHLTALAYLRYQRTVFNVPVADLRELWINYPKNGIKISPREYSTLN
PDSDLLILMDEIFKLKQPLGSFGAYTISTLLTLMSFKDFQSKHPHLYQNEIQKAYEDGYY
FVEFNYFNFREAYHGSLDDGRWWDTILISWAMLESGQDKERIFPIVQNMVKEGLQPKKGI
GYGYDFEYAPDTDDTGLLLVVMSYYKEAFQKQIPETIEWLFSMQNDDGGYPAFDKGKNED
NLLFKFAFNMAGIANSAEIFDPSCPDITGHIMEGLGEFGYQANHPQIQNMIKYQRKTQNK
WGSWQARWGVNYIMAVGAVVPGLARVNYDLNEQWVQNSINYLLNKQNKDGGFGECVLSYN
DPEKWNGIGKSTVTQTSWGLLALLEVYNQNEQIKHAADRAAQYLLDQFKRDDNTFYDHST
IGTGHRGLLYLQYPSYAQSFPLVALNRYQKISQGQYHFSKNLYNGNGEPVQKQNI