Identifiers and Description

Gene Model Identifier

TTHERM_01008660

Standard Name

CTH85 (CaTHepsin 85)

Aliases

PreTt29570 | 194.m00026

Description

CTH85 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF01535 ) PPR repeat
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)
  • ( TIGR00756 ) pentatricopeptide repeat domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09211.1 7.9987533182317575e-115
Description: papain family cysteine protease containing protein (324 aa)
Oxytricha Contig322.1.g116 3.9991604984848653e-48
Description: Papain family cysteine protease
DictyBase DDB_G0272815 2.000704504372864e-47
Description: cprE on chromosome: 2 position 2212329 to 2213613
WormBase WBGene00007055 3.00039543526891e-44
Description: locus:tag-196 status:Confirmed UniProt:O16454 protein_id:CCD64084.1
Stentor Coeruleus SteCoe_29480 2.6102790696677047e-23
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01008660(coding)
ATGAGTTCCAAAATATTCCTAGCTTTATTAGTTTTTACTTGTATTTATTCTTGCTACGCA
TAATAAGGCTCTGTTGTTGAAGCCCTTACTGCTTACAATAAATGGAGAGAAGAAAATGGA
AAGGTTTACTCTAGCGAAGCAGAAAAGATTTACAGATAAAGTGTATTTTTAGAAAATTAT
TAAAGTGTTTAAGAGCACAACAAAAACTCTAATCATACTTACTCAGTTGGCATTAACTAA
TTCTCTGATATTACATTACAAGAATATTAACAAAGAATTCTTATGAAAAATTCTCCATTA
AATGAGCTTGCAAAAAATAAAAATAGATTATTGCAATCTAGCCCTATTTAAAATAGCAAC
GATACTTAAATAGCTTCATCAATTGATTGGAGAAAAAAAGGTGGTGTAAGTCCTGTTAAA
AATTAAGGTGAATGTGGTGGCTGTTGGACTTTCTCTGCAACTGGACTTATGGAGTCTTTT
AATTTAATACACAATAAACCTCAAAATGTTTCACTCTATTCTTAGTAACAACTTTTAGAT
TGCGTAACTCTTGAAAATGGCTATTTTTCTGAAGGATGTGAAGGTGGAGTACCATCTGAT
GCAGTCTAATATGCAGCTGATTTTGGTGTGTTATCTGATAATGAATATCCCTACACTGGT
ATTTAGGGTTAATGCAATATTACTAGTAAAACTAATGGATTCCAACCTGTTTAATTCTCT
TACTTAGATGGTACTGCAGAGGGTTTAAGAAAGGCATTAAATTATGGTCCCGTTTCAGTT
GCTATGGATGCTTCAAATATGAAAGAGTACACATCTGGAGTTTTTAACAACTGTACTTCT
AAATAATTTAACCTGAATCATGCTGTTTTAGCTGTTGGTTATGATGAAGAAGGAAATTGG
ATTATTAAAAACTCTAAAGGTCCTAATTGGGGTATGGAAGGCTATTTCTTGTTGGCACCT
GGTAATACATGTGGTATTTTGGAATTAGACTTTTAAATTACTGCCTGA


>TTHERM_01008660(gene)
ATGAGTTCCAAAATATTCCTAGCTTTATTAGTTTTTACTTGTATTTATTCTTGCTACGCA
TAATAAGGCTCTGTTGTTGAAGCCCTTACTGCTTACAATAAATGGAGAGAAGAAAATGGA
AAGGTTTACTCTAGCGAAGCAGAAAAGATTTACAGATAAAGTGTATTTTTAGAAAATTAT
TAAAGTGTTTAAGAGCACAACAAAAACTCTAATCATACTTACTCAGTTGGCATTAACTAA
TTCTCTGATATTACATTACAAGAATATTAACAAAGAATTCTTATGAAAAATTCTCCATTA
AATGAGCTTGCAAAAAATAAAAATAGATTATTGCAATCTAGCCCTATTTAAAATAGCAAC
GATACTTAAATAGCTTCATCAATTGATTGGAGAAAAAAAGGTGGTGTAAGTCCTGTTAAA
AATTAAGGTGAATGTGGTGGCTGTTGGACTTTCTCTGCAACTGGACTTATGGAGTCTTTT
AATTTAATACACAATAAACCTCAAAATGTTTCACTCTATTCTTAGTAACAACTTTTAGAT
TGCGTAACTCTTGAAAATGGCTATTTTTCTGAAGGATGTGAAGGTGGAGTACCATCTGAT
GCAGTCTAATATGCAGCTGATTTTGGTGTGTTATCTGATAATGAATATCCCTACACTGGT
ATTTAGGGTTAATGCAATATTACTAGTAAAACTAATGGATTCCAACCTGTTTAATTCTCT
TACTTAGATGGTACTGCAGAGGGTTTAAGAAAGGCATTAAATTATGGTCCCGTTTCAGTT
GCTATGGATGCTTCAAATATGAAAGAGTACACATCTGGAGTTTTTAACAACTGTACTTCT
AAATAATTTAACCTGAATCATGCTGTTTTAGCTGTTGGTTATGATGAAGAAGGAAATTGG
ATTATTAAAAACTCTAAAGGTCCTAATTGGGGTATGGAAGGCTATTTCTTGTTGGCACCT
GGTAATACATGTGGTATTTTGGAATTAGACTTTTAAATTACTGCCTGA


>TTHERM_01008660(protein)
MSSKIFLALLVFTCIYSCYAQQGSVVEALTAYNKWREENGKVYSSEAEKIYRQSVFLENY
QSVQEHNKNSNHTYSVGINQFSDITLQEYQQRILMKNSPLNELAKNKNRLLQSSPIQNSN
DTQIASSIDWRKKGGVSPVKNQGECGGCWTFSATGLMESFNLIHNKPQNVSLYSQQQLLD
CVTLENGYFSEGCEGGVPSDAVQYAADFGVLSDNEYPYTGIQGQCNITSKTNGFQPVQFS
YLDGTAEGLRKALNYGPVSVAMDASNMKEYTSGVFNNCTSKQFNLNHAVLAVGYDEEGNW
IIKNSKGPNWGMEGYFLLAPGNTCGILELDFQITA