Identifiers and Description

Gene Model Identifier

TTHERM_01016030

Standard Name

MAC1

Aliases

PreTt02637 | 198.m00057 | 3746.m00321

Description

Appr-1-p processing enzyme family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20179.1 1.0001689416974253e-96
Description: appr-1-p processing enzyme family protein (310 aa)
Oxytricha Contig12236.0.g75 1.999534248571833e-46
Description: Macro domain
Stentor Coeruleus SteCoe_14804 2.6102790696677047e-23
Description: None
DictyBase DDB_G0278229 9.998720540547892e-23
Description: DDB_G0278229 on chromosome: 3 position 512537 to 515209
WormBase WBGene00007106 4.998394530072393e-19
Description: status:Confirmed UniProt:Q17432 protein_id:CAA97408.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23884606: Gao S, Xiong J, Zhang C, Berquist BR, Yang R, Zhao M, Molascon AJ, Kwiatkowski SY, Yuan D, Qin Z, Wen J, Kapler GM, Andrews PC, Miao W, Liu Y (2013) Impaired replication elongation in Tetrahymena mutants deficient in histone H3 Lys 27 monomethylation. Genes & development 27(15):1662-79

Sequences

>TTHERM_01016030(coding)
ATGAATAATATTTTTAGTAAAATATAAAAATTGCCAAAAATGATGAATTTATTTTAACTT
AAAAGTTATTTTAAAACTACCTAAAAACCTACTTATACTATTGGAAACTTATCTTCATAA
CCGATTTTGTAATAAAAGATTGGGGAAACTTAGATATCTATTGTTAAAAATGATCTAACA
ATGGAAAATGTTGATGCGATTGTAAACGCTGCTAATAACTTTTTAGCACATGGAGGAGGA
GTTGCAGGAGCAATTTGCAGAAAGGGAGGAAGAATTATACAAAATTAGAGTTATGACATA
ATAAAAATAAGAAATAGAATTGAAAATGGAGAATCAGTCACTACTGAAGCTGGACAACTT
CCTTGTAAAAAAGTTATTCATACAGTAGGACCTATTTGGGAAGATGGAGACAGTAATGAA
AAAGAAGAGCTAGCTAAATGTATGGAAACAATTTTAAGAGAGGCTAAATTTTATAAATTA
AAATCTATATCTATACCAGCCATATCTTCTGGTATATTTGGATTCCCTAAATATTTGTGC
GCCAAAATTTTGCTAGAAGAAACTTAAAAGCTATTGAAGTATGATTACTCTAATTAATTT
GAAGAAATAAGATTCTGCAACTTTGATAACGAAACAGTTTAGGTATTTGCTGAAGAGTTT
TAAAAGCAATTTTAGAATAAAGAACCCTAGTAGATTGAATAGCAAAGCAAAAAAAAAAAA
GAAAATAATTAAAATGAAGGCCTAAACGAAGATTTTTAGGAAGAACAGAAAGATAATTTG
AAAAACTTAGAGAAACCAAAAATCTAAGACCAAGATCTTTCGAATAATAAGGAAAAGCAA
GCTTAGAAATCATAGGAAGAAAATGAAATTAAGAAATAAGAAATAAAAGAATACAAAGAT
AAACATAGTGAAATTTAAAAGGAACAAAAAAATGAAAACCTTGAAAAATTATCAAAACAA
AAAGAGTGGATTATTAAAGATGCTAAAAATAATATCTCATAAAACCCTAGCTATGTTAAA
TAAAATGAAGGAGATCAAGCAATAGATGCTTAATCTTAGTAGTCCTCATAAGTAAAAGGC
CAATAGAATAAGGTACAAATACTATACAAAAAAATTTGA


>TTHERM_01016030(gene)
ATGAATAATATTTTTAGTAAAATATAAAAATTGCCAAAAATGATGAATTTATTTTAACTT
AAAAGTTATTTTAAAACTACCTAAAAACCTACTTATACTATTGGAAACTTATCTTCATAA
CCGATTTTGTAATAAAAGATTGGGGAAACTTAGATATCTATTGTTAAAAATGATCTAACA
ATGGAAAATGTTGATGCGATTGGTATTTAAAATATATGAAACATGATTCAGAATTAAATG
ATTTAATTAAAATATAAATAAAGTAAACGCTGCTAATAACTTTTTAGCACATGGAGGAGG
AGTTGCAGGAGCAATTTGCAGAAAGGGAGGAAGGTAATTAATTAAATAACAATACTTTTT
AAAAACCCTAAGTTCATTTCTAAATAATTAATAAATAGAATTATACAAAATTAGAGTTAT
GACATAATAAAAATAAGAAATAGAAGTAATTTGAAATTTATTGAATATCTAATTTATTTA
ACTTACTTAATGTACTAATACTAAAATTTAATTTACAAGTTGAAAATGGAGAATCAGTCA
CTACTGAAGCTGGACAACTTCCTTGTAAAAAAGTTATTCATACAGTAGGACCTATTTGGG
AAGATGTATTTAATAAATTTTGAAGTAATTTTACAAATGGATTATTTTTAAAAATTAAGG
GAGACAGTAATGAAAAAGAAGAGCTAGCTAAATGTATGGAAACAATGTAAATAAATGTAC
TTCTAATTTAATTATATTTAAATATTTATTTTTGTAACAAAAGTTTAAGAGAGGCTAAAT
TTTATAAATTAAAATCTATATCTATACCAGCCATATCTTCTGGTATATTTGGATTCCCTA
AATATTTGTGCGCCAAAATTTTGCTAGAAGAAACTTAAAAGTATTATAGATATTCAATTC
ATTTTTTTATAGCTTTTAATTAATTATTTGTCAAATAGGCTATTGAAGTATGATTACTCT
AATTAATTTGAAGAAATAAGATTCTGCAACTTTGATAACGAAACAGTATAAGATTTTAGT
ATATCAATATGACTGATTTTAAATAAATAATAAGGTTTAGGTATTTGCTGAAGAGTTTTA
AAAGCAATTTTAGAATAAAGAACCCTAGTAGATTGAATAGCAAAGCAAAAAAAAAAAAGA
AAATAATTAAAATGAAGGCCTAAACGAAGATTTTTAGGAAGAACAGAAAGATAATTTGAA
AAACTTAGAGAAACCAAAAATCTAAGACCAAGATCTTTCGAATAATAAGGAAAAGCAAGC
TTAGAAATCATAGGAAGAAAATGAAATTAAGAAATAAGAAATAAAAGAATACAAAGATAA
ACATAGTGAAATTTAAAAGGAACAAAAAAATGAAAACCTTGAAAAATTATCAAAAGTAAG
AAATATAAATTTTCTATTTAATTTTAATAGAGTTTTTTTTAGAGTAAAAATTATTTTTTT
CAATTTTATTATTTGTTTTCTTAACAACTTTAAGAAGCATTAAGAAAGTTTAACTATATT
TTAACATAATTTTATTTTATAATTATTAAGCAAAAAGAGTGGATTATTAAAGATGCTAAA
AATAATATCTCATAAAACCCTAGCTATGTTAAATAAAATGAAGGAGATCAAGCAATAGAT
GCTTAATCTTAGTAGTCCTCATAAGTAAAAGGCCAATAGAATAAGGTACAAATACTATAC
AAAAAAATTTGA


>TTHERM_01016030(protein)
MNNIFSKIQKLPKMMNLFQLKSYFKTTQKPTYTIGNLSSQPILQQKIGETQISIVKNDLT
MENVDAIVNAANNFLAHGGGVAGAICRKGGRIIQNQSYDIIKIRNRIENGESVTTEAGQL
PCKKVIHTVGPIWEDGDSNEKEELAKCMETILREAKFYKLKSISIPAISSGIFGFPKYLC
AKILLEETQKLLKYDYSNQFEEIRFCNFDNETVQVFAEEFQKQFQNKEPQQIEQQSKKKK
ENNQNEGLNEDFQEEQKDNLKNLEKPKIQDQDLSNNKEKQAQKSQEENEIKKQEIKEYKD
KHSEIQKEQKNENLEKLSKQKEWIIKDAKNNISQNPSYVKQNEGDQAIDAQSQQSSQVKG
QQNKVQILYKKI