Identifiers and Description

Gene Model Identifier

TTHERM_01016100

Standard Name

RPA12 (RNA polymerase I subunit 12)

Aliases

PreTt02644 | 198.m00064 | 3746.m00328

Description

RPA12 DNA-directed RNA polymerase subunit; DNA-dependent RNA polymerase I subunit

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20171.1 2.0008734984431652e-95
Description: transcription factor S-II (TFIIS) (137 aa)
DictyBase DDB_G0278263 9.997019043202629e-21
Description: rpa12 on chromosome: 3 position 579706 to 580766
SGD YJR063W 7.997402223525235e-19
Description: RPA12 RNA polymerase I subunit A12.2; contains two zinc binding domains, and the N terminal domain is responsible for anchoring to the RNA pol I complex
Oxytricha Contig1475.1.g54 0.00000000000001000191320216021
Description: Transcription factor S-II (TFIIS)
WormBase WBGene00007616 0.000000000003001226732525078
Description: locus:rpoa-12 DNA-directed RNA polymerase subunit status:Confirmed UniProt:O17587 protein_id:CAB02739.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01016100(coding)
ATGGAAATAGATATCAAAAATTTAAATACTGCCAGTGAATTCTGCCCCTAGTGCGGTAAC
ATGATAGAAATGCCTCTTTATTCTGATAAAGTAGAATGTTCAAAGTGTGAATTCTTATGT
TCAGTCCTAGAATATAAGTGCGCTCCTATTGTTTCTAGAATTGAATTTAACTAGAAAAAG
TAATGGCTTGAGTAATATAGAGCCTCATAAAACAAAAAAATACATGGTATAGAAGAAGAA
GATTTGGAAGACAAGCACAAACACAAAAAGGCAACTTTAAAGCAAGAATGTCCTGATTGC
GGTCATGATACTCTTTACTTCTGGACAGTATAAACTCGTTCTGCTGATGAAGGTTCAACA
GTTTTCTACGAATGCTAAGATTGCAAGTTTAAGTTCACTGCAAACAACTGA


>TTHERM_01016100(gene)
ATGGAAATAGATATCAAAAATTTAAATACTGCCAGTGAATTCTGCCCCTAGTGCGGTAAC
ATGATAGAAATGCCTCTTTATTCTGATAAAGTAGAATGTTCAAAGTGTGAATTCTTATGT
TCAGTCCTAGAATATAAGTGCGCTCCTATTGTTTCTAGAATTGAATTTAACTAGAAAAAG
TAATGGCTTGAGTAATATAGAGCCTCATAAAACAAAAAAATACATGGTATAGAAGAAGAA
GATTTGGAAGACAAGCACAAACACAAAAAGGCAACTTTAAAGCAAGAATGTCCTGATTGC
GGTCATGATACTCTTTACTTCTGGACAGTATAAACTCGTTCTGCTGATGAAGGTTCAACA
GTTTTCTACGAATGCTAAGATTGCAAGTTTAAGTTCACTGCAAACAACTGA


>TTHERM_01016100(protein)
MEIDIKNLNTASEFCPQCGNMIEMPLYSDKVECSKCEFLCSVLEYKCAPIVSRIEFNQKK
QWLEQYRASQNKKIHGIEEEDLEDKHKHKKATLKQECPDCGHDTLYFWTVQTRSADEGST
VFYECQDCKFKFTANN