Identifiers and Description

Gene Model Identifier

TTHERM_01016220

Standard Name

IMA1 (IMportin Alpha 1)

Aliases

PreTt02656 | 198.m00076 | 3746.m00340

Description

IMA1 importin subunit alpha; Armadillo/beta-catenin-like repeat family protein; Karyopherin/Importin alpha family member

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20157.1 9.997093137033517e-262
Description: armadillo/beta-catenin repeat family protein (527 aa)
Oxytricha Contig20249.0.g40 4.99764318480009e-123
Description: Armadillo/beta-catenin-like repeat
DictyBase DDB_G0272318 6.999054974866289e-109
Description: DDB_G0272318 on chromosome: 2 position 1278811 to 1280712
SGD YNL189W 2.000234809436283e-103
Description: SRP1 Karyopherin alpha homolog, forms a dimer with karyopherin beta Kap95p to mediate import of nuclear proteins, binds the nuclear localization signal of the substrate during import; may also play a role in regulation of protein degradation
WormBase WBGene00002074 4.000392704867155e-81
Description: locus:ima-3 Importin subunit alpha-3 status:Confirmed UniProt:Q19969 protein_id:CCD70435.1
Stentor Coeruleus SteCoe_15530 4.1863939993042314e-51
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18676955: Malone CD, Falkowska KA, Li AY, Galanti SE, Kanuru RC, LaMont EG, Mazzarella KC, Micev AJ, Osman MM, Piotrowski NK, Suszko JW, Timm AC, Xu MM, Liu L, Chalker DL (2008) Nucleus-specific importin alpha proteins and nucleoporins regulate protein import and nuclear division in the binucleate Tetrahymena thermophila. Eukaryotic cell 7(9):1487-99

Sequences

>TTHERM_01016220(coding)
ATGAATATTTTTAGTAACGTAGAACATTAAAATAGCCAAGACAAAGACAATGACGCCAAA
GAAAAGGCCAGAAGAATGGAAAACCATACTGTTGAGTTAAGAGAAAAGAAGCGTTTAGAT
ATTCTCAGAAAAAATAGAAATATTGACAAGTCAAATTAAGGTTCTGAATAGTCTTAATAA
GAAAGAGGTGGACTTACTCATTAATACTAAGCATTAATGAGCTTGGAGCCTGAATTCAGA
GCCAAGATCGAGTAAATTTACAAGATAACATTCAAGTTCGAGCAAATTGGAGAGTTGGTA
ATTGCTCTCAACTCCTAAGATGTTCTTTTCTAGCACCATGGATGTATTGGTCTTAGAAAG
TTGCTTTCTATTGAAGATTCTCCTCCCATTTAAATTGCCATCGACTCAAATTGTGTTCCT
CGTTTTATTGAATTCATCAAATAAAGTACTTATCCTGTTCTTCAGTTAGAAGCTTCATGG
TGTCTTACTAACATCGCTTCTGGTACCACTCACCAAACACAATCAATTATAGATAAGGGC
GCCATTCCTCTCTTCTGTAAGCTTCTCCTTTCTCCTTTCCAAGATATAGCCGAGCAAGCA
ATTTGGGCTATCGGTAACATTTCAGGTGACTGCAGCGTCTACAGAGACATGATTCTTAAA
TGTGATGGACTCAAGCCTCTTGTTAATATTTTGTTGAATACAAACGATAGAAAAACTATA
AAGCATGGATCTTGGGCACTCAGTAATCTTTGCAGAGGTCGTCCCTTACCTGATTATAAT
CTTGTTTAAGAAGCTGTAAAGCCACTTTGCAAGGTCCTTACGCAAGAAACTGACTCTGAA
GTCCTCACTGATTCTTCATGGGCAATTAGTTACTTGAGTGATGGTGATGAAGATAGAATT
CAACGTATCATTGATACTGGCGTCATTCCTACTTTAATAAGATTAATTAATCACTAATAC
CTTTCTGTATTAATTCCTTGTTTGCGTACTCTTGGTAACGTCTGCACTGGTACTGATGAA
TAAACTGAAGAAGTTCTTAAATATAATGCCCTCCCAGAAATATTTAAGCTTGTTAAGCAC
CAAAAGAAGGCTGTTCGTAGAGAAGCTTGTTGGGTACTTAGTAATATCGCAGCTGGTAAC
GAAAGATAAATTTCATAGATAGTTAATCAACCTTAATATGTTTAATGGCTTTTTGAATGC
ATGATCTAAGATTCTGATGAAATTGCCCGTGAAGCTACTTGGGTCATTTCTAATTGCACT
TCTCAAGCTAATCCCTAAGACATTCGTAAACTTGTAGAAATGAATGTATTAAAGATATAT
ACTGACATTCTTAAATCTACAAAGGACGTTAAAACAATAGCTGTTATTTTAGAATCATTA
AAACACATTCTCGAATGTGGTAAAAATAACTTTATGTAAGGCAACGATAACCCTTTCTGC
ATTCAATTAGAGTAATTCGGTGCTTTAGACTTTATTGAAGAACTTTAAAGACATCCTGAT
GATGATGTTTATAGAAGATCTCTCGCTATCCTTGAAAATTACTTTGATTTAGAAGATGAA
TAAGTTATTAGACCTGAATGA


>TTHERM_01016220(gene)
ATGAATATTTTTAGTAACGTAGAACATTAAAATAGCCAAGACAAAGACAATGACGCCAAA
GAAAAGGCCAGAAGAATGGAAAACCATACTGTTGAGTTAAGAGAAAAGAAGCGTTTAGAT
ATTCTCAGAAAAAATAGAAATATTGACAAGTCAAATTAAGGTTCTGAATAGTCTTAATAA
GAAAGAGGTGGACTTACTCATTAATACTAAGCATTAATGAGCTTGGAGCCTGAATTCAGA
GCCAAGATCGAGTAAATTTACAAGATAACATTCAAGTTCGAGCAAATTGGAGAGTTGGTA
ATTGCTCTCAACTCCTAAGATGTTCTTTTCTAGCACCATGGATGTATTGGTCTTAGAAAG
TTGCTTTCTATTGAAGATTCTCCTCCCATTTAAATTGCCATCGACTCAAATTGTGTTCCT
CGTTTTATTGAATTCATCAAATAAAGTACTTATCCTGTTCTTCAGTTAGAAGCTTCATGG
TGTCTTACTAACATCGCTTCTGGTACCACTCACCAAACACAATCAATTATAGTAATTTTA
TTTGCTTAAAACTAAAAGATACTACAAACAATCTTAAAAGTTTATAAACAAAACTTTTAC
TTCAATAATATGGGATTTTAAAGAATATTTAAAAGAATTCTATTTTATTTCACTATATTT
TAATAGATAAAAGAAGATTTTACTCGAAATTTATGCTTTTGTAGTTTTTAGCATTAAAAA
ATAGTTGTTTTATTAATCAAATTAATATTTTTTTAAATTTATAAAGGATAAGGGCGCCAT
TCCTCTCTTCTGTAAGCTTCTCCTTTCTCCTTTCCAAGATATAGCCGAGCAAGCAATTTG
GGCTATCGGTAACATTTCAGGGTAAGAATTTTGAATTGATTATTAGCAGATAAATTTTAA
AACTCAAAATAAAAAATTTTTAAGATCTTCAAAAATTTTGTTTGAATAGCAATTAATTAA
TATTAATTTATCTTGATCTTCTAAACAAAAAAGTTCGCGCAATAATTTATTAAATAATAT
AAATTTCATTACAAAAATATCCTAAGTAAAAATATTTGACTTTGATATATTAGCTTAAAA
GGAAAAAATAAATTATAATATAAAAAGGAGGAGGAAATTTCCTTTAAAAGTAAAAACGAT
TGAGCTATTTATTTATTTATTTGATCAAATAATTTATTTACGAAAGCATTTCTTAGCATC
CACTTTCTTATTTTAATTTTATTTAGAACGCGCCTATTAATAGTGAGTAATATAGACAAT
TTTTAGAGGACTCTCTATTATTTTTTCAAGCAATTTTTCGACTTAAGTTATTAATTTATT
TATAAGCTTAAAAAGACTTACAATTTTTCTAGATAGTTAGAGAGAGATATATATATAGAT
AAATATAAATATAAATAAATAAATTGCGAATTCTAATAAAATTTAAATTTAAAAATTTAA
ATTCATAAATGAATTGAAAATAATTTTAATTAATTGAATTTTTCAATTTTTTTCATCTTT
TAAAATTGTTTTTATTTTAAATAGTGACTGCAGCGTCTACAGAGACATGATTCTTAAATG
TGATGGACTCAAGCCTCTTGTTAATATTTTGTTGAATACAAACGATAGAAAAACTATAAA
GCATGGATCTTGGGCACTCAGTAATCTTTGCAGAGGTCGTCCCTTACCTGATTATAATCT
TGTTTAAGAAGCTGTAAAGCCACTTTGCAAGGTCCTTACGCAAGAAACTGACTCTGAAGT
CCTCACTGATTCTTCATGGGCAATTAGTTACTTGAGTGATGGTGATGAAGATAGAATTCA
ACGTATCATTGATACTGGCGTCATTCCTACTTTAATAAGATTAATTAATCACTAATACCT
TTCTGTATTAATTCCTTGTTTGCGTACTCTTGGTAACGTCTGCACTGGTACTGATGAATA
AACTGAAGAAGTTCTTAAATATAATGCCCTCCCAGAAATATTTAAGCTTGTTAAGCACCA
AAAGAAGGCTGTTCGTAGAGAAGCTTGTTGGGTACTTAGTAATATCGCAGCTGGTAACGA
AAGATAAATTTCATAGATAGTTAATCAACCTTAATATGTTTAATGGCTTTTTGAATGCAT
GATCTAAGATTCTGATGAAATTGCCCGTGAAGCTACTTGGGTCATTTCTAATTGCACTTC
TCAAGCTAATCCCTAAGACATTCGTAAACTTGTAGAAATGAATGTATTAAAGATATATAC
TGACATTCTTAAATCTACAAAGGACGTTAAAACAATAGCTGTTATTTTAGAATCATTAAA
ACACATTCTCGAATGTGGTAAAAATAACTTTATGTAAGGCAACGATAACCCTTTCTGCAT
TCAATTAGAGTAATTCGGTGCTTTAGACTTTATTGAAGAACTTTAAAGACATCCTGATGA
TGATGTTTATAGAAGATCTCTCGCTATCCTTGAAAATTACTTTGATTTAGAAGATGAATA
AGTTATTAGACCTGAATGA


>TTHERM_01016220(protein)
MNIFSNVEHQNSQDKDNDAKEKARRMENHTVELREKKRLDILRKNRNIDKSNQGSEQSQQ
ERGGLTHQYQALMSLEPEFRAKIEQIYKITFKFEQIGELVIALNSQDVLFQHHGCIGLRK
LLSIEDSPPIQIAIDSNCVPRFIEFIKQSTYPVLQLEASWCLTNIASGTTHQTQSIIDKG
AIPLFCKLLLSPFQDIAEQAIWAIGNISGDCSVYRDMILKCDGLKPLVNILLNTNDRKTI
KHGSWALSNLCRGRPLPDYNLVQEAVKPLCKVLTQETDSEVLTDSSWAISYLSDGDEDRI
QRIIDTGVIPTLIRLINHQYLSVLIPCLRTLGNVCTGTDEQTEEVLKYNALPEIFKLVKH
QKKAVRREACWVLSNIAAGNERQISQIVNQPQYVQWLFECMIQDSDEIAREATWVISNCT
SQANPQDIRKLVEMNVLKIYTDILKSTKDVKTIAVILESLKHILECGKNNFMQGNDNPFC
IQLEQFGALDFIEELQRHPDDDVYRRSLAILENYFDLEDEQVIRPE