Identifiers and Description

Gene Model Identifier

TTHERM_01018420

Standard Name

THD8 (Tetrahymena Histone Deacetylase 8)

Aliases

PreTt27759 | 199.m00052

Description

THD8 SIR2 family transcriptional regulator; Sir2-like histone deacetylase; suppresses DNA transcription by deacetylation of histones

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00098 ) Zinc knuckle
  • ( PF02146 ) transcriptional regulator, Sir2 family

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_01121.1 9.997093137033517e-262
Description: transcriptional regulator, Sir2 family protein (386 aa)
Oxytricha Contig19063.0.g74 4.999450098932641e-139
Description: Sir2 family
Stentor Coeruleus SteCoe_10597 2.8946403116483003e-63
Description: None
WormBase WBGene00004803 3.0000451088882257e-25
Description: locus:sir-2.4 NAD-dependent protein deacetylase sir-2.4 status:Confirmed UniProt:Q95Q89 protein_id:CCD61225.1
DictyBase DDB_G0283917 8.997498379799854e-17
Description: sir2A on chromosome: 4 position 1272110 to 1273864
SGD YPL015C 0.0000000000000030004923591262316
Description: HST2 Cytoplasmic member of the silencing information regulator 2 (Sir2) family of NAD(+)-dependent protein deacetylases; modulates nucleolar (rDNA) and telomeric silencing; possesses NAD(+)-dependent histone deacetylase activity in vitro

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82

Sequences

>TTHERM_01018420(coding)
ATGAATACAGCTCATAAAACAGACGATGAAAAAAAGGAATTCTTTGATTCACCTAAAGAA
TTAGAAGAAAAAGTAAATATTTTAGTTGATATGATAAAACGTTCTGAGCACTTTGTTGCT
TTTACAGGTGCAGGTATTTCTACTTCTACTGGAATTCCAGATTTTAGAAGTGGTATCAAT
ACAGTACTTCCAACTGGTCCAGGTGCATGGGAAAAATTAGCTTAAAAGACAGGCAGCTCT
AAAAGTAATGTAAAAGTAAGCATGTCTAAGGCAATACCATCTCCTACTCATATGTCTCTT
GTTGAATTACAGAGATAAGGATATCTTAAATTTTTGATAAGTTAGAATGTAGATGGTTTA
CACAGAAGAAGTGGATTTTCTACTTACCACTTAGCCGAATTGCATGGCAACACAAATCTA
GAAAAATGCTAGAAGTGTGGCAAAGAATACATGAGAGATTTTAGAGTCAGAACAGCCCAA
TAAGTACATGATCATAAAACTGGTAGAAAGTGTGATAATTAATAATGTAACGGAGATCTA
TATGACTCTATTATAAATTTTGGTGAAAACCTCCCTGAAAAAGACTAAGATGATGGATTC
GTTCATTCTTAGTTGGCTGATTTGCATTTAGTTTTAGGAAGCAGTTTAAGAGTAACTCCT
GCAGCTGATATGCCTGAAACTACAGCAAAATTAGGAAAAAATTTAGTTATTGTTAATTTG
TAAAAGACTCCTCTTGATTCTTTAGCTACTCTCAGAATAAATGCCATGTGTGATGATGTT
ATGAAAATGGTTATGAAAAAGCTTAAAATAGAAATCCCAGAATTTATCTTAGAAAGAAGG
ATAGTCCTTTAAAAGGGAGATAAAAACAGTTTACTTGTTTCTGCAGAAGATTCAAATGAA
AGTCCTTATGAAATATATAAAAAAGTTACAATTGAATATGGAAAAGCAAACGAAGCTAAA
TAAAAAGCTCCTTTCAATTTCACCCCCAAGCAAAACCAATTCACAGTGAGTTTAGGTTTC
TATGAACATTATGGAGAGTAAGAATTCAAATTAGATGTTGATATGATAGCTTTACCACTC
AATAAAAAAGTGGTTTACTAAATATAATATTAAGTTAGTCTCTAAAAATGGATAAGCTGC
AAACAAATATGA


>TTHERM_01018420(gene)
ATGAATACAGCTCATAAAACAGACGATGAAAAAAAGGAATTCTTTGATTCACCTAAAGAA
TTAGAAGAAAAAGTAAATATTTTAGTTGATATGATAAAACGTTCTGAGCACTTTGTTGCT
TTTACAGGTGCAGGTATTTCTACTTCTACTGGAATTCCAGATTTTAGAAGTGGTATCAAT
ACAGTACTTCCAACTGGTCCAGGTGCATGGGAAAAATTAGCTTAAAAGACAGGCAGCTCT
AAAAGTAATGTAAAAGTAAGCATGTCTAAGGCAATACCATCTCCTACTCATATGTCTCTT
GTTGAATTACAGAGATAAGGATATCTTAAATTTTTGATAAGTTAGAATGTAGATGGTTTA
CACAGAAGAAGTGGATTTTCTACTTACCACTTAGCCGAATTGCATGGCAACACAAATCTA
GAAAAATGCTAGAAGTGTGGCAAAGAATACATGAGAGATTTTAGAGTCAGAACAGCCCAA
TAAGTACATGATCATAAAACTGGTAGAAAGTGTGATAATTAATAATGTAACGGAGATCTA
TATGACTCTATTATAAATTTTGGTGAAAACCTCCCTGAAAAAGACTAAGATGATGGATTC
GTTCATTCTTAGTTGGCTGATTTGCATTTAGTTTTAGGAAGCAGTTTAAGAGTAACTCCT
GCAGCTGATATGCCTGAAACTACAGCAAAATTAGGAAAAAATTTAGTTATTGTTAATTTG
TAAAAGACTCCTCTTGATTCTTTAGCTACTCTCAGAATAAATGCCATGTGTGATGATGTT
ATGAAAATGGTTATGAAAAAGCTTAAAATAGAAATCCCAGAATTTATCTTAGAAAGAAGG
ATAGTCCTTTAAAAGGGAGATAAAAACAGTTTACTTGTTTCTGCAGAAGATTCAAATGAA
AGTCCTTATGAAATATATAAAAAAGTTACAATTGAATATGGAAAAGCAAACGAAGCTAAA
TAAAAAGCTCCTTTCAATTTCACCCCCAAGCAAAACCAATTCACAGTGAGTTTAGGTTTC
TATGAACATTATGGAGAGTAAGAATTCAAATTAGATGTTGATATGATAGCTTTACCACTC
AATAAAAAAGTGGTTTACTAAATATAATATTAAGTTAGTCTCTAAAAATGGATAAGCTGC
AAACAAATATGA


>TTHERM_01018420(protein)
MNTAHKTDDEKKEFFDSPKELEEKVNILVDMIKRSEHFVAFTGAGISTSTGIPDFRSGIN
TVLPTGPGAWEKLAQKTGSSKSNVKVSMSKAIPSPTHMSLVELQRQGYLKFLISQNVDGL
HRRSGFSTYHLAELHGNTNLEKCQKCGKEYMRDFRVRTAQQVHDHKTGRKCDNQQCNGDL
YDSIINFGENLPEKDQDDGFVHSQLADLHLVLGSSLRVTPAADMPETTAKLGKNLVIVNL
QKTPLDSLATLRINAMCDDVMKMVMKKLKIEIPEFILERRIVLQKGDKNSLLVSAEDSNE
SPYEIYKKVTIEYGKANEAKQKAPFNFTPKQNQFTVSLGFYEHYGEQEFKLDVDMIALPL
NKKVVYQIQYQVSLQKWISCKQI