Identifiers and Description

Gene Model Identifier

TTHERM_01018450

Standard Name

THD12 (Tetrahymena Histone Deacetylase 12)

Aliases

PreTt27762 | 199.m00055

Description

THD12 SIR2 family transcriptional regulator; Sir2-like histone deacetylase; suppresses DNA transcription by deacetylation of histones; homolog of Mus muscalus SIRT6

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF02146 ) transcriptional regulator, Sir2 family

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_01119.1 9.997093137033517e-262
Description: transcriptional regulator, Sir2 family protein (387 aa)
Oxytricha Contig19063.0.g74 1.0001788721085356e-149
Description: Sir2 family
Stentor Coeruleus SteCoe_10597 1.9503933001302485e-65
Description: None
WormBase WBGene00004803 3.0010664139725277e-29
Description: locus:sir-2.4 NAD-dependent protein deacetylase sir-2.4 status:Confirmed UniProt:Q95Q89 protein_id:CCD61225.1
DictyBase DDB_G0283917 5.998633383648922e-18
Description: sir2A on chromosome: 4 position 1272110 to 1273864
SGD YPL015C 0.00000000000004998767099442072
Description: HST2 Cytoplasmic member of the silencing information regulator 2 (Sir2) family of NAD(+)-dependent protein deacetylases; modulates nucleolar (rDNA) and telomeric silencing; possesses NAD(+)-dependent histone deacetylase activity in vitro

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82

Sequences

>TTHERM_01018450(coding)
ATGGATACTGCACACAAAACAGAAGATGAAAAAAAGGAATACTTCGATGCTCCTGATGTT
TTAGAATAAAAGGTTACTCTTTTAGCTGAAATGATTAAAACTTCAAAGCACTTTGTAGCT
TTCACAGGAGCAGGAATTTCTACTTCTACAGGAATTCCTGATTTTAGAAGTGGAATTAAC
ACTGTTCTTCCTACTGGACCAGGAGCTTGGGAGAAATTAGCCTAAAAAGTTGATAATAAG
CATAAAAATATCAAGACTAGCATGTTGAAAGCTATTCCTTCACCCACACATATGGCTTTG
GTTTAGTTACAAAAAATAGGTTATTTGAAATTCCTTATTAGCTAAAATGTAGACGGATTG
CACAGAAGAAGTGGTTTCTCACCCTAACACTTAGCTGAATTGCATGGCAATACAAATCTT
GAAAAATGTAAAAAATGTGGCAAAGAATACTTGAGAGATTTTAGAGTTAGAAATGCATAG
AAAGTTCATGATCACAAAACAGGTAGAAAGTGCAGCGATTAAAAATGCAAAGGAGATCTT
TATGACTCTATTATAAATTTTGGTGAAAATTTACCTGAAAAAGATTTAAATGAAGGATTT
GCTTAATCAAAAAAATCTGATTTGCATTTGGTTTTAGGAAGTAGTTTAAGAGTAACACCT
GCTGCAGACATGCCTGCCACCACTGCAGAAAAAGGTCAAAAATTAGTTATAATAAACTTG
CAAAAAACTCCTTTAGACTCAGTAGCTACTCTCAGAATAAATGCTATGTGTGATGATGTT
ATGAAAATGGTTATGAAAAAACTTGGATTAGATATACCAGAATTCACTCTTGAAAGAAGA
GTTGTCTTAGAAAAAACAGGTATGAATGCCTTAACAGTTTCAAGCTAAGACTCGGACGAT
TCCCCCTATGATTTGTTTAAATAAATTAAAGTAGATTACGGCAAAATACATCCTGAATAA
ACTTTACTTAAGGCTCCATTCAATATCATACCAAAAAATAAAACATTCTCTCTAAATTTA
AGCTTTTATGGACACTATGGCGAGCAAGATTTTAACTTAAATATCGATATGGCTGCTCTC
TCCATTAATAAAAAAGTGAAATATTTAATACAATATTCACCAAAAGAATAAAAATGGATT
AGTTGCAAAGAAATATGA


>TTHERM_01018450(gene)
ATGGATACTGCACACAAAACAGAAGATGAAAAAAAGGAATACTTCGATGCTCCTGATGTT
TTAGAATAAAAGGTTACTCTTTTAGCTGAAATGATTAAAACTTCAAAGCACTTTGTAGCT
TTCACAGGAGCAGGAATTTCTACTTCTACAGGAATTCCTGATTTTAGAAGTGGAATTAAC
ACTGTTCTTCCTACTGGACCAGGAGCTTGGGAGAAATTAGCCTAAAAAGTTGATAATAAG
CATAAAAATATCAAGACTAGCATGTTGAAAGCTATTCCTTCACCCACACATATGGCTTTG
GTTTAGTTACAAAAAATAGGTTATTTGAAATTCCTTATTAGCTAAAATGTAGACGGATTG
CACAGAAGAAGTGGTTTCTCACCCTAACACTTAGCTGAATTGCATGGCAATACAAATCTT
GAAAAATGTAAAAAATGTGGCAAAGAATACTTGAGAGATTTTAGAGTTAGAAATGCATAG
AAAGTTCATGATCACAAAACAGGTAGAAAGTGCAGCGATTAAAAATGCAAAGGAGATCTT
TATGACTCTATTATAAATTTTGGTGAAAATTTACCTGAAAAAGATTTAAATGAAGGATTT
GCTTAATCAAAAAAATCTGATTTGCATTTGGTTTTAGGAAGTAGTTTAAGAGTAACACCT
GCTGCAGACATGCCTGCCACCACTGCAGAAAAAGGTCAAAAATTAGTTATAATAAACTTG
CAAAAAACTCCTTTAGACTCAGTAGCTACTCTCAGAATAAATGCTATGTGTGATGATGTT
ATGAAAATGGTTATGAAAAAACTTGGATTAGATATACCAGAATTCACTCTTGAAAGAAGA
GTTGTCTTAGAAAAAACAGGTATGAATGCCTTAACAGTTTCAAGCTAAGACTCGGACGAT
TCCCCCTATGATTTGTTTAAATAAATTAAAGTAGATTACGGCAAAATACATCCTGAATAA
ACTTTACTTAAGGCTCCATTCAATATCATACCAAAAAATAAAACATTCTCTCTAAATTTA
AGCTTTTATGGACACTATGGCGAGCAAGATTTTAACTTAAATATCGATATGGCTGCTCTC
TCCATTAATAAAAAAGTGAAATATTTAATACAATATTCACCAAAAGAATAAAAATGGATT
AGTTGCAAAGAAATATGA


>TTHERM_01018450(protein)
MDTAHKTEDEKKEYFDAPDVLEQKVTLLAEMIKTSKHFVAFTGAGISTSTGIPDFRSGIN
TVLPTGPGAWEKLAQKVDNKHKNIKTSMLKAIPSPTHMALVQLQKIGYLKFLISQNVDGL
HRRSGFSPQHLAELHGNTNLEKCKKCGKEYLRDFRVRNAQKVHDHKTGRKCSDQKCKGDL
YDSIINFGENLPEKDLNEGFAQSKKSDLHLVLGSSLRVTPAADMPATTAEKGQKLVIINL
QKTPLDSVATLRINAMCDDVMKMVMKKLGLDIPEFTLERRVVLEKTGMNALTVSSQDSDD
SPYDLFKQIKVDYGKIHPEQTLLKAPFNIIPKNKTFSLNLSFYGHYGEQDFNLNIDMAAL
SINKKVKYLIQYSPKEQKWISCKEI