Identifiers and Description

Gene Model Identifier

TTHERM_01020700

Standard Name

ABC1 (ABC family protein 1)

Aliases

PreTt17637 | 200.m00050 | 3756.m00246

Description

ABC1 ABC1 family protein; ABC1 family protein kinase; fusion of aarF domain containing protein and ubiquinone biosynthesis protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_19285.1 9.997093137033517e-262
Description: ABC1 family protein (763 aa)
Oxytricha Contig21891.0.g8 3.999369102302453e-125
Description: ABC1 family
WormBase WBGene00008410 6.001309080488961e-82
Description: status:Confirmed UniProt:O17735 protein_id:CAB02876.1
DictyBase DDB_G0284897 9.996907204735647e-62
Description: abkD on chromosome: 4 position 2611033 to 2613269
SGD YLR253W 7.999270105144775e-57
Description: YLR253W Putative protein of unknown function; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies; transcription is periodic during the metabolic cycle; YLR253W is not an essential gene
Stentor Coeruleus SteCoe_7677 7.781132241133797e-20
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_01020700(coding)
ATGAATTTTATTAGGAGAAATAAGTTTAAAATTTTAGGTACTGCACTAATCTCTCCTTTC
GCATTAGTTTATGGTGCAGGCTTTTATTATTTTCCAGAATTAAGACATAATTAAAGTTAA
ATGATTAAAGCTTTAATACGTACAGGTAGAGTAGCTATAGCAGGAGCAAGAATGGCAAAT
ATATATATGAAAGATGATAATCGAAGCATCGAGACAAAACACAATGAAGCCTCATTGATT
TTAAAAGATGCTTTTGTAAAAAATGCTGGACTATACTTAAAATTTGCATAATTACTATCA
TCACTCGATGTTGTTGTACCAGAAGAATATAGAAGAAATTTTGAACCATTGTGTCATGAG
TGTCCAGAAAATAGTTTTTAAAATGTAAAACATTCAATAGAAAGCTCATTAAGAAAACCA
ATAGATGAGGTATTTTCAGAGTTTAATCCAAAGCCACTAAAATCGGCATCTATTGCTTAA
GTTCATGAGGCCGTTTTAAAAGAAACAGGTGAGAGAGTTGCTGTTAAGGTGATGCATGAC
TGGTTGTAAGAATCTAGTAAAGGAGATTTAAAAGTAATAGGTCTATTTGTTGATATAGGA
GAATTATTATTTCCAGAATTTAAATTCAAGTGGTTTTCAGAAGAATTAAATTAAATTCTA
CCTCAAGAATTAAACTTCTTGGATGAAGTTAAAAACAGTGAGAGAGCCAGATAAATATTG
AAAGATAAACCTAACATTTATGTTCCTATAAACCACTTTGGCCTTTGCAATAGTAAAATA
ATTACTATGGAATTTATTGATGGATTCCCAATTATGGATGTGCCAACTCTGAAGAGAGAA
AAATTTGACATGAAAAAAATTGCCTATACAATAAGTGATACATTTTCTTAAATGATATTT
TAAAATGGATTTGTTCATAGCGATCCTCATTAAGGAAATCTTTTATTAAGGAAAGTAAAA
GATCCTAAAAACCCTCACAAAACCATAGACCAAGTTGTTCTTTTGGATCATGGGTTATAT
AAAAATCTATCTCCATAGTTTAGATTGAGTTATAGCAAACTTTGGAAAGGTATAATAACT
CAAAACGAAGAACTTATCTAAAAGTCTTCAATCGAGTTAGGTGTTAAAGAAGATTAATAC
CCTCTCTTTGCCTCTATGATTACTAGCAGAACATACGAAGATTTGATGGATGATAAAAAA
TCTGTAAAAGAGCGTTTAAGAAGTCCTTAAAACTAAGAAGAAAGAGATAAAATAGCAATA
AATGCAGCCAAATACCATAGATAGATTATTTAAATATTACACCAAATGAACAGATCTCTG
CTACTCTTATTAAAAACAACTGATTTCTTAAGGACTATAGACAACAAATTAGGAAGCCCA
GTAAATACCTTTGAAATAACACTTGACTATTGCTTTAATGAAATAGAAAAATTCGAATTC
AATAATTCTTTTTGGCTATTTTTACTCTTTAGATTTGAAAAAATAATGGCTAAGATTAAA
TTATTTATTTATAAATAATTATTACCTTAACCTTAATTAAATTGA


>TTHERM_01020700(gene)
ATGAATTTTATTAGGAGAAATAAGTTTAAAATTTTAGGTACTGCACTAATCTCTCCTTTC
GCATTAGTTTATGGTGCAGGCTTTTATTATTTTCCAGAATTAAGACATAATTAAAGTTAA
ATGATTAAAGCTTTAATACGTACAGGTAGAGTAGCTATAGCAGGAGCAAGAATGGCAAAT
ATATATATGAAAGTATGAATATCATCAAAATATTAAGTTAAAATAATTTTATTTATTTGC
TAGGATGATAATCGAAGCATCGAGACAAAACACAATGAAGCCTCATTGATTTTAAAAGAT
GCTTTTGTAAAAAATGCTGGACTATACTTAAAATTTGCATAATTACTATCATCAGTAATT
TTATCTTTTGCAAGAGAGATATGATAAAATATTTTTTTTCCATTTAATTATTTATAATTA
AAAAGCTCGATGTTGTTGTACCAGAAGAATATAGAAGAAATTTTGAACCATTGTGTCATG
AGTGTCCAGAAAATAGTTTTTAAAATGTAAAACATTCAATAGAAAGCTCATTAAGAAAAC
CAATAGATGAGGTATTTTCAGGTAAAAGCTAAAAATATATCGAATAGAAATATTCAATGT
TATTTTATTTATAGAGTTTAATCCAAAGCCACTAAAATCGGCATCTATTGCTTAAGTTCA
TGAGGCCGTTTTAAAAGAAACAGGTGAGAGAGTTGCTGTTAAGGTGATGCATGACTGGTT
GTAAGAATCTAGTAAAGGAGATTTAAAAGTAATAGGTCTATTTGTTGATATAGGAGAATT
ATTATTTCCAGAATTTAAATTCAAGTGGTTTTCAGAAGAATTAAGTATTTTTATTATATA
AATAAAACATTTCTTTATATTTCAAATGAAAAGCTGGACATTTCTTTCTTATAATTATCC
AATTGGTATATTGTAAATTCTAGTTAAACTGATTAATATTTTAATTAAAATAGATTAAAT
TCTACCTCAAGAATTAAACTTCTTGGATGAAGTTAAAAACAGTGAGAGAGCCAGATAAAT
ATTGAAAGATAAACCTAACATTTATGTTCCTATAAACCACTTTGGCCTTTGCAATAGTAA
AATAATTACTATGGAATTTATTGATGGATTCCCAATTATGGATGTGCCAACTCTGAAGAG
AGAAAAATTTGACATGAAAAAAATTGCCTATACAATAAGTGATACATTTTCTTAAATGAT
ATTTTAAAATGGATTTGTTCATAGCGATCCTCATTAAGGAAATCTTTTATTAAGGAAAGT
AAAAGATCCTAAAAACCCTCACAAAACCATAGACCAAGTTGTTCTTTTGGATCATGGGTT
ATATAAAAATCTATCTCCATAGTTTAGATTGAGTTATAGCAAACTTTGGAAAGGTATAAT
AACTCAAAACGAAGAACTTATCTAAAAGTCTTCAATCGAGTTAGGTGTTAAAGAAGATTA
ATACCCTCTCTTTGCCTCTATGATTACTAGCAGAACATACGAAGATTTGATGGATGATAA
AAAATCTGTAAAAGAGCGTTTAAGAAGTCCTTAAAACTAAGAAGAAAGAGATAAAATAGC
AATAAATGCAGCCAAATACCATAGATAGATTATTTAAATATTACACCAAATGAACAGGTA
AAGTTGAATCTATAAACAAGTTAAAAATAATTTTTATTTAAAAAGATCTCTGCTACTCTT
ATTAAAAACAACTGATTTCTTAAGGACTATAGACAACAAATTAGGAAGCCCAGTAAATAC
CTTTGAAATAACAGTAATTTATTGATTTTTAATCATAATAATTTAAAATAAAACATTTTT
ATGAATAACAGCTTGACTATTGCTTTAATGAAATAGAAAAATTCGAATTCAATAATTCTT
TTTGGCTATTTTTACTCTTTAGATTTGAAAAAATAATGGCTAAGATTAAATTATTTATTT
ATAAATAATTATTACCTTAACCTTAATTAAATTGA


>TTHERM_01020700(protein)
MNFIRRNKFKILGTALISPFALVYGAGFYYFPELRHNQSQMIKALIRTGRVAIAGARMAN
IYMKDDNRSIETKHNEASLILKDAFVKNAGLYLKFAQLLSSLDVVVPEEYRRNFEPLCHE
CPENSFQNVKHSIESSLRKPIDEVFSEFNPKPLKSASIAQVHEAVLKETGERVAVKVMHD
WLQESSKGDLKVIGLFVDIGELLFPEFKFKWFSEELNQILPQELNFLDEVKNSERARQIL
KDKPNIYVPINHFGLCNSKIITMEFIDGFPIMDVPTLKREKFDMKKIAYTISDTFSQMIF
QNGFVHSDPHQGNLLLRKVKDPKNPHKTIDQVVLLDHGLYKNLSPQFRLSYSKLWKGIIT
QNEELIQKSSIELGVKEDQYPLFASMITSRTYEDLMDDKKSVKERLRSPQNQEERDKIAI
NAAKYHRQIIQILHQMNRSLLLLLKTTDFLRTIDNKLGSPVNTFEITLDYCFNEIEKFEF
NNSFWLFLLFRFEKIMAKIKLFIYKQLLPQPQLN