Identifiers and Description

Gene Model Identifier

TTHERM_01044740

Standard Name

MRNO10 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt05923 | 209.m00060 | 3760.m00248

Description

kinase domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_20383.1 9.997093137033517e-262
Description: hypothetical protein (1538 aa)
Oxytricha Contig1068.0.0.g83 2.999758165421992e-18
Description: MORN repeat

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01044740(coding)
ATGAACGGATATGGAAAACTTTATTACCCATCCGGCTAATTAGCGTATGAAGGTAAATGG
AAAGATGATAAATTTGATGGAAGAGGAGTTATTTATAATGAAAAGCCTATCCCTATAAGC
TATGGAGAAGAAATAGACTTTTAAGATTTTAATAAAATGTCTGAAGAATGGACAAAGTTT
GACGGAGAATTTAAAATAGATGAAAAAACTGGATTTGGAACCTTTTATTTCAGTAATTCT
TCAAAGTTTTAATGTAACTTTATGAACGATATGGCTGAAGGAGTGGGTACTTTCACATTA
TCAGATGGAAAAACTCAAATCGTTGGGGATTGGAAATAAAACATTTTAGTTAATATTTAC
CAATAAAAATAAATAAATCATTGA


>TTHERM_01044740(gene)
ATGAACGGATATGGAAAACTTTATTACCCATCCGGCTAATTAGCGTATGAAGGTAAATGG
AAAGATGATAAATTTGATGGAAGAGGAGTTATTTATAATGAAAAGCCTATCCCTATAAGC
TATGGAGAAGAAATAGACTTTTAAGATTTTAATAAAATGTCTGAAGAATGGACAAAGTTT
GACGGAGAATTTAAAATAGATGAAAAAACTGGATTTGGAACCTTTTATTTCAGTAATTCT
TCAAAGTTTTAATGTAACTTTATGAACGATATGGCTGAAGGAGTGGGTACTTTCACATTA
TCAGATGGAAAAACTCAAATCGTTGGGGATTGGAAATAAAACATTTTAGTTAATATTTAC
CAATAAAAATAAATAAATCATTGA


>TTHERM_01044740(protein)
MNGYGKLYYPSGQLAYEGKWKDDKFDGRGVIYNEKPIPISYGEEIDFQDFNKMSEEWTKF
DGEFKIDEKTGFGTFYFSNSSKFQCNFMNDMAEGVGTFTLSDGKTQIVGDWKQNILVNIY
QQKQINH